SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000018445 from Oreochromis niloticus 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000018445
Domain Number 1 Region: 574-832
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 8.98e-90
Family Eukaryotic proteases 0.00000537
Further Details:      
 
Domain Number 2 Region: 326-432
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 5.36e-28
Family Spermadhesin, CUB domain 0.00063
Further Details:      
 
Domain Number 3 Region: 214-319
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.01e-21
Family Spermadhesin, CUB domain 0.0016
Further Details:      
 
Domain Number 4 Region: 72-164
Classification Level Classification E-value
Superfamily SEA domain 0.000000000523
Family SEA domain 0.011
Further Details:      
 
Domain Number 5 Region: 472-508
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000654
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 6 Region: 434-473
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000668
Family LDL receptor-like module 0.0015
Further Details:      
 
Domain Number 7 Region: 510-543
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000798
Family LDL receptor-like module 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000018445   Gene: ENSONIG00000014650   Transcript: ENSONIT00000018462
Sequence length 834
Comment pep:novel scaffold:Orenil1.0:GL831175.1:896990:918149:1 gene:ENSONIG00000014650 transcript:ENSONIT00000018462 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDSLDSGQKFSPKRDNDFEEAFLPAPDHKDLEKKSCNKKWTGIGVALVIGVLAVTALLVG
LFCQPQHVKMKRIYIGSMEINNKKFLPQYEDPRSSEFTNLAAQVSKQLKLMYSKNSVLDR
YFNHSSVQAFSEGDSGPNTIVAYYESEFDVPPPQQASLDEAIDSMQPPEGGKGRFLLKPT
DALSVNDIVSQAIDPRLTKTKFSERKSFDIHIENSGHVESPGFPNSPYPSNAYLQWKFRA
DPQHRIQLDFDDLILEDDCQRDFIKIYDSLVPIEKRAMTEQCGYPHQSLSFISSGNVMLL
MLVTNEEKNFPGFRANYSPIPQTTLNCGGTLTGEKGSISSPFFPSNYPPRTTCVWNIEVA
NNKFLKVLFNKFSLGNKTEGCGHDYVEINGERLCGSDLKSPVFTINSNKMTITFKSDSSY
VDQGFTAEYEAFTPNNPCPGRFACSNNLCINNTLRCDGWGDCGDDSDEINCKCDASQIQC
KNGHCKPKFWLCDGVDDCGDNTDEENCETCKGQFSCKNGRCIAENLKCNGKDDCGDASDE
SKCEKSLVLQTCSEFTYQCKNKLCISKMNPECDGVQDCTDDSDEDNCECGIRPYRSSRIV
GGQASREGEWPWQVSLHFKGMAHVCGASVLSDRWLLTAAHCVQDKFSQANQWEALLGLHE
QSQTSKWTMKRGVKRIIVHPGYDRDTYDNDITLMELDSSVTLNQNIWPICLPSPAHDFPV
GEEAWITGWGATREGGFGATVLQKAAVRIINSTVCKSLLTDPVTDNMLCAGVLTGGVDAC
QGDSGGPLSFTSTKGRVFLAGVTSWGEGCARKNKPGIYTRVTKYRNWIKENSGV
Download sequence
Identical sequences I3KBF0
XP_003446045.1.78416 ENSONIP00000018445 ENSONIP00000018445

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]