SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000018575 from Oreochromis niloticus 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000018575
Domain Number 1 Region: 22-64
Classification Level Classification E-value
Superfamily UBA-like 0.0000107
Family TAP-C domain-like 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000018575   Gene: ENSONIG00000014754   Transcript: ENSONIT00000018592
Sequence length 280
Comment pep:novel scaffold:Orenil1.0:GL831272.1:1360279:1368179:-1 gene:ENSONIG00000014754 transcript:ENSONIT00000018592 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEGTDMDVDAELMQKFSCMGTTDKDVLISEFQRLLGFQLNPAGCAFFLDMTNWNLQAAIG
AYYDFESPNVNTPSMSFVEDVTIGEGESVPPDTLFTKTWRIQNTGAESWPPGVCLKYIGG
DQFGHVNTVMVKSLDPQEISDVSVQMRSPTTPGMYQGQWRMCTATGLFYGDVIWVILSVE
VGGLLGVTQQLSSFETEFNTQPQRNVQGDFNPFASPQKNKHDATDNSFRDPGGAWERTQE
PIQQDQNGLSHNAVNRASNGLQTNLSVVTYGQGPYPFGQS
Download sequence
Identical sequences I3KBT0
ENSONIP00000018575 ENSONIP00000018575 XP_003453743.1.78416 XP_005918000.1.24487 XP_006782927.1.46954

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]