SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000018632 from Oreochromis niloticus 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000018632
Domain Number 1 Region: 753-829,858-945
Classification Level Classification E-value
Superfamily RUN domain-like 1.1e-31
Family RUN domain 0.0015
Further Details:      
 
Domain Number 2 Region: 1109-1278
Classification Level Classification E-value
Superfamily RUN domain-like 4.45e-27
Family RUN domain 0.013
Further Details:      
 
Domain Number 3 Region: 963-1052
Classification Level Classification E-value
Superfamily Lipase/lipooxygenase domain (PLAT/LH2 domain) 0.0000000000637
Family Lipoxigenase N-terminal domain 0.04
Further Details:      
 
Weak hits

Sequence:  ENSONIP00000018632
Domain Number - Region: 533-572
Classification Level Classification E-value
Superfamily Cyanovirin-N 0.0392
Family Cyanovirin-N 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000018632   Gene: ENSONIG00000014798   Transcript: ENSONIT00000018649
Sequence length 1292
Comment pep:novel scaffold:Orenil1.0:GL831142.1:3196322:3212420:-1 gene:ENSONIG00000014798 transcript:ENSONIT00000018649 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RMNTAAATGSASCRFAHYFVVCGVDTETGLEPDDGAAIYYLSRLSWLFFINQSCCHILMP
SGEGFEHSPVRRSFKSKVLAHYPENTDRNPFNKDAVNMLCMPRGLSFRTQADRLDPQFHS
FTISFDDGTRSYGFVHTFYEEVTSPQIITAMQTLCQMHHVEHHSSSLASSPSSSSSSASS
PSTSSMDSLASSSDESDVESLAGVSGCFGCVGSFDSTRDTLYVSKALCLVTPLPFLQASR
QFLVQLHQAVTSQTAPPLPLESYIHNILYEVPLPPPGRSLRFHGVQGPILCQRPGPGELP
LGEYPLGDAFSLLGVDNMVKLLTCALLETQVLLYSSDYQRLMTVAEGINTLLFPFQWQHI
YLPIISAPLHHLLDAPVPFLMGIQRRDGAQRSSLNLPHEANLCFVDIDNHCVEAPEDLPQ
FPDQTELIQELSEVLLQFGLPPQGGVIAKPTTTSSSSPRLSSLVLEDLMEDRRNGNLGGE
ELAVLERLQALARRCGGGKMSDGGKTLGHVFEEEEEELKAAKLNIQLREVFAGHFAAMFG
RYDDFVIHSALDLDSWLSNREGMFNFDKGSFLSVQPTSHLHFLSRFLETSMFSSFVDGKV
ISRWADREPLQQLFDSRLERERLYDTGSEDSCGCLYRKCTTLFESGQAIERRLLKADHTA
IHPHLLDMRIGQGRHHPGYFPKLQADVLAQAQNTNKWSSRVTASRRSEPKRSTVSDQSGV
DNEQRQKYTFARKNLRQSKLLDLTPQAITQTHREFVDGLLSECRLKTKRMLKERMGKESV
ELGQGEASITGLQENTLIHGLCDLLERTWGHGLQVKQGKSALWSHLLHYQAAQGKMEAPA
ESPGSNCSDQRTVDDGALPLRGLLVQDMRFIQTMSEGLSDVGQARAWIHLALEKKMLSQH
LKELLTNQELLRQLYKPHAFLLCEEEREQFLFHLLSLNTVDYLCFTRVFTSVCIPYRVVI
IPMKKLSIAMATVDPWVCVSGELGDSGVRQIPKNTQEIFFQCKNLGRLSTLQLGQENSGL
LAKCLIDCVMVYNEITGHTYKFPCGRWLGKGVGDGSLERVLIGQLVSPGAEEDAGRLTGT
PPPELASPSQSVRIVLGSLGSRSRMLSVEVQEDMREAVNNLVKHFHKPEQERGNLTVLLC
GEGGLVLCLEKFLLHGLKSNRLFQRNVFVWDFVEKAVASMETADQMGDLHGSILTKGPPC
DLLCHYVSAINASPRNIGKEGKFQLFVCLGIRDRLLSLWLPLLADCPLTARTYEDGALLR
DRAAVHSLSRMLHTLNEFIITLETALVKGVDL
Download sequence
Identical sequences I3KBY7
ENSONIP00000018632 ENSONIP00000018632

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]