SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000018753 from Oreochromis niloticus 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000018753
Domain Number 1 Region: 13-118
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 4.58e-34
Family Spermadhesin, CUB domain 0.0003
Further Details:      
 
Domain Number 2 Region: 134-258
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 6.54e-20
Family Spermadhesin, CUB domain 0.0043
Further Details:      
 
Domain Number 3 Region: 257-293
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000223
Family LDL receptor-like module 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000018753   Gene: ENSONIG00000014897   Transcript: ENSONIT00000018770
Sequence length 517
Comment pep:novel scaffold:Orenil1.0:GL831142.1:4097813:4104816:-1 gene:ENSONIG00000014897 transcript:ENSONIT00000018770 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PQRHCGNWVRTTDGGTFSSPNYPNTYPPNKECLYVLEALPRQRIELMFDEVFHIEASFEC
RFDHIEVRDGPFSFSPLINRFCGSASPGLILSSGRFMWIRFFSDEELEGTGFQVQYSFTA
DPEFHLHVGGLLNPIPDCQFELSGADGVIRSSQVDEEYKVKPDQAVDCIWTIRAPTKNRI
YLRFLEYQMENSNECKKNFVAVYDGSNAIEDLKAKFCSTVANDIMLDTGVGVVRMWADET
SRLSRFRMLFTSFADPPCMGGAFFCHTNMCINTSLVCNGIQNCVFPWDESNCKEKKNKGL
FHQITKTHGTIICVSTGVVLLLLIVSILVQVKQPRKKVLVRKNNLFPRADFQEVFDPPHY
ELFNLRDKEISSRDLGELSEELQSLQALRRSSSGSRCIHEHHCGSLASINSIKGSLGAQG
LGRGSMELPAFRVDFQNSLPPLRDFNSSLRKKSWPSMKSGRIQGHHGMGERALGRQDRVM
EEDEEEEEDGRYDVYVRRAGSRRGYEMAQQRSLSMDF
Download sequence
Identical sequences I3KCA8
ENSONIP00000018753 ENSONIP00000018753

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]