SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000018792 from Oreochromis niloticus 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000018792
Domain Number 1 Region: 488-599
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.15e-24
Family Spermadhesin, CUB domain 0.0017
Further Details:      
 
Domain Number 2 Region: 304-422
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.62e-16
Family Spermadhesin, CUB domain 0.0043
Further Details:      
 
Domain Number 3 Region: 665-726
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000132
Family Complement control module/SCR domain 0.00099
Further Details:      
 
Domain Number 4 Region: 605-666
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000162
Family Complement control module/SCR domain 0.0014
Further Details:      
 
Domain Number 5 Region: 247-311
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000417
Family Complement control module/SCR domain 0.0014
Further Details:      
 
Domain Number 6 Region: 733-791
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000013
Family Complement control module/SCR domain 0.0011
Further Details:      
 
Domain Number 7 Region: 131-248
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.0000000000017
Family Spermadhesin, CUB domain 0.011
Further Details:      
 
Domain Number 8 Region: 427-492
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000167
Family Complement control module/SCR domain 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000018792   Gene: ENSONIG00000014927   Transcript: ENSONIT00000018809
Sequence length 890
Comment pep:novel scaffold:Orenil1.0:GL831663.1:6460:23515:-1 gene:ENSONIG00000014927 transcript:ENSONIT00000018809 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGFTRLVTLSVTVIHLVSGMSFMTPEPDTPPTSPPDSYPLGDMIHAALQSKEYLGRASAG
TGTTTNPTQAAPGMGQTESTAIAMSPGLLTTALSSSSAASQTGSRNTMSPLPIEEETTTT
LITTTTITTMHMPVQCNATLLAMEDVVESPDPAASSSFSPLECTYSITVYAGYGVEIQVR
KANLSKDESLTIMGYGGSGPELLANETLMKQGQVIRSTTNQVYIHYRSLRQTNHGMFSLH
YQAFLLSCPFPMSPEGGGVTVTDIHPGGQAHFHCDPGFQVRGHEVATCVNMTQPRWSTPE
PQCVAVSCGGWIRNATVGRILSPPPPSVSNHSNGNNLSCHWLIEAKEGHRLHLHFERIAL
DEDDDKLIVRSGNSSLAPTLFDSDMDDVPERGLLSESSTLYLELTADSSSIPLLLALRYE
AFDDEHCWEPYMPHGNFSSSDISYQLGTTVTFTCSPGFVMEQGSGTIECVDPSNPHWNDS
EPVCRALCGGELTEPSGTILSPDWPQSYSKGLDCMWQIHGNEEKRIELDVQILNIRHTDV
LTIFDGRDLTSHVIGQYLGSKERFQVVSGGSEVAIQFQSDLDDSSFILSQGFLIHYREVE
PNDTCPTLPNIEFGWISSSHTSPVRGSVLTYQCQPGYDISGSDIITCQWDLSWSSSPPTC
VKVQQCPDPGEVVNGARSVRPETGFAVGTVVRFSCNQGYQLEGPSQISCYGRDTGTPKWS
DRSPKCVLKYDPCPNPGVPDNGYQTLYKHTYQAGETLRFFCYEGYELIGEVIISCVPGHP
SQWNSPPPFCKVAYEELLDDHKLEVSQSFQPSHQILSENIALAIILPIILVILLIGGIYM
YYTNICRLEWKPHFWKSLSHTHSYSPITVESDFNNPLYEAGDTREYEVSI
Download sequence
Identical sequences I3KCE7
XP_005465668.1.78416 ENSONIP00000018792 ENSONIP00000018792

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]