SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000018833 from Oreochromis niloticus 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000018833
Domain Number 1 Region: 1-86
Classification Level Classification E-value
Superfamily Ubiquitin-like 3.68e-21
Family Ubiquitin-related 0.0000422
Further Details:      
 
Domain Number 2 Region: 274-337
Classification Level Classification E-value
Superfamily XPC-binding domain 5.1e-20
Family XPC-binding domain 0.0000721
Further Details:      
 
Domain Number 3 Region: 349-404
Classification Level Classification E-value
Superfamily UBA-like 0.00000000000116
Family UBA domain 0.00044
Further Details:      
 
Domain Number 4 Region: 177-232
Classification Level Classification E-value
Superfamily UBA-like 0.00000000000269
Family UBA domain 0.00067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000018833   Gene: ENSONIG00000014959   Transcript: ENSONIT00000018850
Sequence length 406
Comment pep:novel scaffold:Orenil1.0:GL831299.1:134809:147296:-1 gene:ENSONIG00000014959 transcript:ENSONIT00000018850 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLITLKTLQQQTFKIDIDEEETVRTLKERIEQEKGKEIFSVAGQKLIYAGKILSDDSPLK
EYKIDEKNFVVVMVTKLTLSDSSKPTELPKESAAIPCDATADPAESSLKPKKAPTASQPS
TAAPAPSTTAPAAQSDSSSTSDKPAEQSSTDDKPEESQPSTTEASSTSVGRSGDAANLIS
EAVSNLVTGSSYDAMVNEMMLMGYEREQVVAALRASFNNPDRAMEYLLTGIPSRNQGNAS
GRDAVAPPASGTPAVPAGNASAPANTRSSPSAGGGNPLSFLRNQPQFQVMRQLIQQNAAL
LPALLQEIGRENPELLQEISSHQEQFIQMLNEPVPEPVPGGGSSGAGGGGGNQMNYIQVT
PQEKEAIERLKALGFPEGLVIQAYFACEKNENLAANFLLQQNFDED
Download sequence
Identical sequences I3KCI8
ENSONIP00000018833 ENSONIP00000018833

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]