SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000018847 from Oreochromis niloticus 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000018847
Domain Number 1 Region: 254-406
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 1.42e-51
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.0000006
Further Details:      
 
Domain Number 2 Region: 409-567
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 2.2e-43
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.00000363
Further Details:      
 
Domain Number 3 Region: 13-117
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 9.55e-34
Family Spermadhesin, CUB domain 0.00026
Further Details:      
 
Domain Number 4 Region: 122-240
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 5.1e-30
Family Spermadhesin, CUB domain 0.00000455
Further Details:      
 
Domain Number 5 Region: 607-775
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 6.96e-30
Family MAM domain 0.0044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000018847   Gene: ENSONIG00000014970   Transcript: ENSONIT00000018864
Sequence length 919
Comment pep:novel scaffold:Orenil1.0:GL831188.1:1364070:1455486:1 gene:ENSONIG00000014970 transcript:ENSONIT00000018864 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DKCGGSIEIHAADYLTSPGYPSAYPPSQQCVWVITAPEAGQKILINFNPHFDLEDRDCKY
DYVEVYNGGDESSPMLGKFCGKIAPSPIISTGGQLLIKFVSDYETHGAGFSVRYEVFKTG
PECSRNFTAPSGVIKTPGFPEKYPNNLECTFMIFAPKMTEIVVEFDSFDMEPDTTPPPGA
LCRYDWLEIWDGFPAVGPHIGRYCGQTSPGRVISYTGILSMTITTDNAIAREGFSANYTI
RERTLPPGHEDEDFACMEPLGMESGEISSDQITASSQYNSNWSPERSRLNYQENGWTPSD
DNTREWIQVDLGFLRFVKAIGTQGAISKETKKHYYVRTYKVDLSSNGEDWVTVKDGSKPK
SFLGNYNPTDEVRSHLPKPTLARYIRIRPTSWEQGICMRFEIYGCRTSDYPCSGMLGMVS
GQISDAQISASSYADRGWVAENARLLTGRSGWTGQSTKQPFKNEWLQVDLGQDKIVTGVV
IQGGKHRDRNVFMKKFKVGHSLDGEEWTMVKEENTTRVKVFLGNQNHDTPELRSMGPLIT
RLIRIYPERATIEGVGLRLELLGCELEEQSLGPDTASDFSPSGYLTRPRHSGIPLRTPVS
TVGAYLWFACNFDFSSFCGWTRETGTGAEWIIQANGAPAVHRGPPLDHMGQPGNFIYMQL
TDSDTPSKTGEDEDKEEKVARLASLPITSPDSDLCMSFWYHTVGEHAGALHIKHRKETEE
GEILWTLSGHQGSRWREGRVILPHSSVPYQVVVEGIADRRSLSYIAVDNIQIMDGVRAED
CKVSRKSPFVLFQQLQLTRNKEIISKAGTYRPQEGIFTIPPNKYTYCPHVNKSQPLLELS
NKTRNMLKTLDPILITIIAMSALGVFLGAICGVVLYCACSQGSMTDRNLSALENYNFELV
DGVKLKKDKINGQTNYSEA
Download sequence
Identical sequences I3KCK2
ENSONIP00000018847 ENSONIP00000018847

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]