SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000018853 from Oreochromis niloticus 69_1.0

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSONIP00000018853
Domain Number - Region: 64-152
Classification Level Classification E-value
Superfamily Bacterial hemolysins 0.000837
Family Hemolysin E (HlyE, ClyA, SheA) 0.049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000018853   Gene: ENSONIG00000014976   Transcript: ENSONIT00000018870
Sequence length 410
Comment pep:novel scaffold:Orenil1.0:GL831176.1:945450:957693:1 gene:ENSONIG00000014976 transcript:ENSONIT00000018870 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGGLGNGRRGGRSPPLMIAALIACILVLGFNYWVSSSRNLELQTKLYELEGQVRRGAAER
GADEMKKKEFEQEIQKQKDQISNIQSLYKRQLEGAENTCSQHKATLQQNISSSAKTIQEL
KGQLNRLNDALGKLEKDLQSCQGNINTLNNKLMYDMTQCNAQVLSQKELCDERVAAAKLE
ADKKMQKLIHTPVSSQQENVGGVEINKSVKALSDGIPATASSQTPSLSQLKGNKVHELLT
NEIMVDIVPSAPVEQPTSKDLSKAGPKSVPSAAALKQEDKQPQEGADKADEVEGETGKLV
ENNLTEDKENEAMNAHEEDPQIEEADPGMEGMLIGRGKADETQDGQKLQEPEEYDADEQV
VGGEDLEKPQENKQDENIDKVMEDELADYNGDDENEGEFEADKQAELAQN
Download sequence
Identical sequences I3KCK8
ENSONIP00000018853 ENSONIP00000018853 XP_003446160.1.78416

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]