SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000018901 from Oreochromis niloticus 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000018901
Domain Number 1 Region: 465-521
Classification Level Classification E-value
Superfamily UBA-like 0.0000000000462
Family UBA domain 0.0036
Further Details:      
 
Domain Number 2 Region: 16-85
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.000000000168
Family Ubiquitin-related 0.0078
Further Details:      
 
Weak hits

Sequence:  ENSONIP00000018901
Domain Number - Region: 323-382
Classification Level Classification E-value
Superfamily XPC-binding domain 0.00745
Family XPC-binding domain 0.0042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000018901   Gene: ENSONIG00000015013   Transcript: ENSONIT00000018918
Sequence length 522
Comment pep:novel scaffold:Orenil1.0:GL831176.1:1275688:1286104:1 gene:ENSONIG00000015013 transcript:ENSONIT00000018918 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSAAVKDETTTSRHRRRAERIHVTVTSVTESRDFIVRGDCTVRQFKWGLSEHLGASAEEL
VLIHSSRVLKDSEPLSHLKGQNGSVRLSMIQRPQHSSAPPPTDPDLDPEPDNITPSPTSP
LCLVEGLDSLVLENSGTSFFPELQRQMENRLLADPEMMHRLLGSPFVQSTLSTSSPQLIR
QLILSNPQIQQLLQTNPEVKDMLNDEDVITQLLELIKNPDMIEEMMKNEDKALENLQSEQ
ENPEVITGNSDPEAKLQKVGASASVTTSPRNHHILEGESNQMFFGRSTDPLSELTATSRA
GSNSQSSITAGMQSLLEEITASPGLLESLLSGPYVSSLLNCLSQNPDLAAQMLLSHPLLA
GNPQLEQQMRKEIPVFLQQMQAPELLSAMLNPRAMEALLQIQQGLHTLATEAPALIPANA
LGNTGTGIGAASEHPSDSIPNSQSGSGQQAASATEQQQQQFVQQMLQALANTNNEVHHTE
REFKEELEQLSSMGFRDKKANLQALISTGGDLTTAIQHLLSL
Download sequence
Identical sequences I3KCQ6
ENSONIP00000018901 XP_003446167.1.78416 ENSONIP00000018901

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]