SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000018957 from Oreochromis niloticus 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000018957
Domain Number 1 Region: 370-741
Classification Level Classification E-value
Superfamily RCC1/BLIP-II 3.05e-95
Family Regulator of chromosome condensation RCC1 0.00072
Further Details:      
 
Domain Number 2 Region: 4089-4435
Classification Level Classification E-value
Superfamily RCC1/BLIP-II 2.62e-91
Family Regulator of chromosome condensation RCC1 0.01
Further Details:      
 
Domain Number 3 Region: 4567-4911
Classification Level Classification E-value
Superfamily Hect, E3 ligase catalytic domain 6.02e-89
Family Hect, E3 ligase catalytic domain 0.000064
Further Details:      
 
Domain Number 4 Region: 3499-3603,3658-3790,3833-3903
Classification Level Classification E-value
Superfamily WD40 repeat-like 3.11e-34
Family WD40-repeat 0.012
Further Details:      
 
Domain Number 5 Region: 2032-2214
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.27e-33
Family SPRY domain 0.011
Further Details:      
 
Weak hits

Sequence:  ENSONIP00000018957
Domain Number - Region: 2813-2873
Classification Level Classification E-value
Superfamily UBA-like 0.00589
Family UBA domain 0.017
Further Details:      
 
Domain Number - Region: 1745-1999
Classification Level Classification E-value
Superfamily ARM repeat 0.0345
Family MIF4G domain-like 0.079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000018957   Gene: ENSONIG00000015060   Transcript: ENSONIT00000018974
Sequence length 4935
Comment pep:novel scaffold:Orenil1.0:GL831436.1:400245:481871:-1 gene:ENSONIG00000015060 transcript:ENSONIT00000018974 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALMIPPVKLKWLEHLNSSWITEDSESIATREGVSVLYSKLLANKEVVLLPQQVLCLKGP
QLPDFERESLSSDEQEHYLDALLSSQLALAKMVCSDSPFAAALRKRVLVLQRVFYALSNK
YHDKGKVKQHQHSLENNSGSADLHSVSERPRSSTDALIEMGVRTGLSLLFALLRQSWMMP
TAPNPGGSPGSNINLCNDVIHTAIDVVSSLPALSLANESKIPPMGLDCLSQVTTFLKGVT
MPNSGADILGRRLASELLLGLASQRGSLRYLLEWIEMALAASAVVSTMEQNKLLQNQEGL
ISYDCFMNILMQMRRSLGSSADRSQWREPTRTSDGLCSLYEAALCLFEEVCRMASDYSRT
CVSPDSIQTGETPVVSETCEVYVWGSNSSHQLVEGTQEKILQPKLASSFADAQTIEAGQY
CTFVISSDGSVRACGKGSYGRLGLGDSNNQSTLKKLTFEPHRAIKKVSSSKGSDGHTLAF
TTEGEVFSWGDGDYGKLGHGNSSTQKYPKLIQGPLQGKVVVCVSAGYRHSAAVSEDGELY
TWGEGDFGRLGHGDSNSRNIPTLVKDISNVGEVSCGSSHTIALSKDGRTVWSFGGGDNGK
LGHGDTNRVYKPKVVEALQGMFIRKVCAGSQSSLALTSTGQVYAWGCGACLGCGSSEATA
LRPKLIEELATTRVVDISIGDSHCLALSHDNEVYAWGNNSMGQCGQGNSTGPITKPKKVI
GLDGVAIQQISAGTSHSLAWTALPRDRQVVAWHRPYCVDLEESTFSHLRSFLERYCDGIN
SEVPPLPFPSSREHHNFLKLCLRLLSNHLALALAGGVATSILGRQARPLRNLLFRLMDSS
VPDEIQEAVIETLSVGATMLLPPLRERMELLHSLLPQGPDRWESLSKGQRMQLDIILTSL
QDHTHVASLLGYSSPADGPEVLSSGPAFTALPEPAYGTTTGHPDTHLAEILMKTLLRNLG
FYTDQAFGELEKNSDKLQQGTSSSDSSQPAHLHQLLCSLQKQLLAYCHINSVTENSSSVS
LLHKHLQLLLPHATDIYSRSAALIKESSWNGSIREKLQDVIYVSAAGSMLCQIINALLLL
PVSVARPLLSQLLELLPPLDCLNRLLPAASPLEDQELQWPLQGTSDFAEPASGMTLPQPA
LSWVWLVDLERTVALLVGRCLGGMLQGAPTSLEEQDTVYWLKTPLFSNGLEMDIPQLDTC
ISSLLEAALSGNEEQKPFDCTLHPDLSVLVDLALGSSKEPANSLWINMHEYAIGKDWDNA
SLSNETLLDTVSRFVLAALLKHTGLLGQACGEGRYQPSKSLAEVYRSVFKVRNRLLACKN
MDFIQTRSSSRERRISDNQDSLDMDPQEHSFTRTIDEEAELEERVDREREEGHQEQDDEE
DDREHEVMTAGKIFQCFLSAREVARSRERERASSSTGLGSSSRNGGGGGGEEDTILAQEG
RRGSTGLPEGQDLYTAACNSVIHRCALLILGVSPVLGELTKQNQEEAQTQLATGTQECLS
FMTRSESLSAESRLVQSSPSYRLMKSRSESDLSQPESDEEGYTLNGRRNVDLDLAFSHKK
RGLLHSSPDSLAESWFRAKLSRQQSYSSTYEESDLDLSRSLGIHALIDNMVSFISGDVGL
APAFKEPEESMSTSPQAIILAMEQQQSRAELRLEALHQIVVLISGMEEKGSQLNNADRSS
AVFQSSSLLTSVRLQFLAGCFGLGTVGTGVLKRENVQLHHYQDGVKAAKRSLQMEIQTAV
HKIYQQLSVTLERALQANKHHIEAQQRLLLVTVFALSVRYQPVDVSLAISSGLLNVLSQL
CGTETMLGQPLQLLQKPGVSQLSTALKVASTRLLQILAISTGTYADKLSPKVVQSLLDLL
CSQLKNLLSQAGVSLLHAGKEQEDGKHEDSADSERKDFRALLRKQHTAELHLGDFLVFLR
RVVSSKAIQSKMASPKWTEVLLNIAAQKCCSGVPLVGNLRTRLLALHVLEAVLPACEASM
EDDQMTQVIERLFSLLSDCMWEGPIAQTKHSIQIKEKVQELKLQGDTEEEDENLPIQEIS
FDPEKAQCCVVENGQGLTHGSGGKGYGLASTGISSGCYQWKFYIVKENRGNEGTCVGVSR
WPVHDFNHRTTSDMWLYRAYSGNLYHNGEQTLTLSSFTQGDFITCVLDMEARTVSFGKNG
EEPKLAFEDVDATELYPCVMFYSSNPGEKVKICDMQMRGTPRDLLPGDPVCSPVATVLAE
ATIQLIRILHRTDHWTHRINKTMIERLHKIKPCFRESAGASGGGLGQRLKKSRSVQSREE
HDTQRESQETPTRTDEEKGRHGRQHGLGELSEHHLRTLCTEVWPVLAVIGGADAGLRVGG
RCVHKQTGRHATLLGVTKEGSTSAKVQWDEAEVTISFPTFWSPSDTPLYNLDPCEPLPFD
VARFRGLTASLLLDLTYLTSIHEDTTTKLSARRHEKKHRNTPSTGHEPTGGEEKTDGEGH
NRNDSKDNAGAPSAATTSDLRVSHSLDEVKAHVAPNSKSESEISSVAGGGVGGNESLFTS
SAHAPADGNRKKGHDHGCRSHEPSPSAITTQSEIHAVQLSYLYLGAMKTLSALLSCSKYA
ELLLIPKVLPEATPSGHNADLNTCTSGNTAATSPVYQDEVEMRAALQFLMRHMVKRAVMR
SPIKRALGLADLERAQAMIYKLVVNGLLEEPSGGKAKPGVRSEPEGEGEVTEGEQLAQTP
VTTSPSASSTTSFMSSSLEDTTTATTPVTDTETVPASESPGVMPLSLLRQMFSSYPTTTL
VPTRRAQTPPVSSLPTSPSDEVGRRQSLTSPDSQPSRPQNRTGTSLSDPSSRLSTSPPPP
AIAVPLLEMGFSLRQITKALEATGARGEVDAQNITVLAMWMIEHPGTEDEHDEPHARGGG
VNGEASDSSCPGATAITGAKSLDKNSYLCSPGVIASADTSEVEEGFSESPEGLEQDSASA
SSSAPLRGRSAAGRKHRFDLAARTLLARAAGLYRSVQAHHSQSRREVSSLQQQQDPGALY
DFNLDEELEMDLDEETMEAMFGQDLASDTDILGMWIPEVLDWPTWHVCETDDRDEVVVCE
LCEANVANFNQHMKKSHPGCGRSANRQGYRSNGSYVDGWFGGECGSGNPYYLLCGGCREK
YLAIKSKAKVPIVERYKGQAPDLLGKQDSVYEEDWDMLDVDEDEKLTGEEEFELLAGPLG
LSERRIVPEAVQFPDSDPLGASIAMVTATNSMEETLLQIGCQTSVDKSSSGRVTLGEQAA
ALQNPHDRVMALRRVTAAAQVLLARTMVMRALSLLSVSGSSCSLAAGLESLGLTDIRTLV
RLMCLAAAGRAGLSTSPSAGPGHAERPRGATKTSKPISCLAYLSTAVGCLASNSPNAAKL
LVQLCTQNLISAATGMNLTTVDDPIQRKFLPSFLRGVAEENKLVTSPNFVVTQALVALLA
DKGARLRPAYDKADMEKRGPLELANALAACCLSSRLSSQHRQWGAQQLVRTLAAHDRDNN
QNRPQTFADMAGDLRKCSFIKLEAHQSRVITCGWCSKKGLLATSGNDGTVRVWNVTKSQY
TLQQTCVFNKDDDSLEEGMSGLGSPSDPCLSPLAWSVTGKYLASAMEKMVNIWQVNGGKG
LLDVQPHWVSALTWPEEEAESLWCGEPKDMLLVGRMDGSLGLIEVLDSSGMHRTELEHCY
RKDVAIMHIAWYSEDKPFAVGYADGKLLIGSKEPLDKGAIVVIDAHKESISSMKWSPTGQ
ILLTCAKEETVKLWANPDSCSDTGSGWHCLQSLRHPSLVNGVAWCSLPGCSPKPLSMFAV
CCQNGLVSVWTVPQDISNFTDSCSSDSEGWWENEAKPKLMQSSRWSEDGAVCVFQLKGHI
TPVRTLAFSPDGLALASGGVGGLMNIWSLRDGSVLQTVVAGSGAVQNIVWVSDVGVAVCS
NRSKDVLVVNCSKEFMASNHVLATCRTALKKQGVVGLNLAPCMRAFLERLPVMLQEQYAY
EKPHVVCGEQLVHSPYMQCLASLAVGLHLDQLLCRPPVPPHLRHCPPESGIAVWSASEWA
WLDCFSTTVKAAEALARGAAFPESFSVPDLEPVPKDEMALLLDNSKWSASMDEQIMSWAT
SRPEDWHLGGKCDVFLWGAGRHGQLAEAGRNILVPTIAPSFSQAQQVVCGQNCTFVIQPN
GTVLACGEGSYGRLGQGNSDDLHVLTVISALQESGEVFSWGDGDYGKLGHGNSDRQRRPR
QIEALQGEEVVQMSCGFKHSAVVTADGKLFTFGNGDYGRLGLGNTSNKKLPEKVTALEGY
HVGQVACGLNHTLVVSADGMMVWAFGDGDYGKLGLGNSTAKSSPQKVDVLCGIGIKKVAC
GTQFSVALTKDGKVFTFGQDRLIGLPEGRARNHNRPQQVPGLSGIHIQDVAVGAEHTLVL
SSTGDVYTWGSNSEGQLGLGHTNHVREPTLVTTLQGKNIHQISAGRCHSAAWTAPSVPPR
APGSSVPLQLGLPAAVPPQYSGLKELSIEAVRARLRLLYHFSDLMYSSWRLLNLSPNNQS
CTSHYNAGTWGIVQGQLRPLLAPRVYTLPMVRSIGKTMVQGKNYGPQITVKRISTRGRKC
KPIFVQIARQVVKLNASDLRLPSRAWKVKLVGEGADDAGGVFDDTITEMCQELETGVVDL
LIPSPNATAEVGYNRDRFLLNPSACLDEHMLQFKFLGILMGVAIRTKKPLDLHLAPLVWK
QLCCIPLLLEDLEEVDLLYVQTLKSILHIEDSGITEDNFHEMIPLDSFVGQSADGKMVPI
IPGGNSIPLTFSNRKEYVERAIEYRLHEIDRQVAAVREGMSWIVPVPLLSLLTAKQLEQM
VCGMPEICCDVLKKVVRYREVDEQHSLVQWFWQTLEEFSNEERVLFMRFVSGRSRLPANT
ADISQRFQIMKVDRPYDSLPTSQTCFFQLRLPPYSSQAVMAERLRYAINNCRSIDMDNYM
LSRNVDNAEGSDTDY
Download sequence
Identical sequences I3KCW2
ENSONIP00000018957 ENSONIP00000018957

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]