SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000019128 from Oreochromis niloticus 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000019128
Domain Number 1 Region: 29-163
Classification Level Classification E-value
Superfamily Cupredoxins 1.58e-50
Family Ephrin ectodomain 0.000000284
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000019128   Gene: ENSONIG00000015197   Transcript: ENSONIT00000019145
Sequence length 229
Comment pep:novel scaffold:Orenil1.0:GL831176.1:3818497:3923184:-1 gene:ENSONIG00000015197 transcript:ENSONIT00000019145 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLQVEMVVFVCLVLLMCVFSQEPSSKVVADRYAVFWNRTNTKFHRGDYHIDVCINDYLDV
YCPHYEDTVPEERTERYVLYMVNYDGYSTCDHTAKGFKRWECNRPHSPNGPLKFSEKFQL
FTPFSLGFEFRPGREYYYISSTVAENGKKTCLKLKVFVRPANSCVKTIGVHDRVFDVNDK
VDNTLEPRDDTSHEPAEPSRSETNDVPRLQKTSPLLASMLICLAALSTL
Download sequence
Identical sequences I3KDD3
XP_003446197.1.78416 ENSONIP00000019128 ENSONIP00000019128

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]