SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000019262 from Oreochromis niloticus 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000019262
Domain Number 1 Region: 923-956
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.000000413
Family A20-like zinc finger 0.019
Further Details:      
 
Weak hits

Sequence:  ENSONIP00000019262
Domain Number - Region: 4-42
Classification Level Classification E-value
Superfamily UBA-like 0.000156
Family TAP-C domain-like 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000019262   Gene: ENSONIG00000015307   Transcript: ENSONIT00000019279
Sequence length 958
Comment pep:novel scaffold:Orenil1.0:GL831142.1:7391280:7436426:1 gene:ENSONIG00000015307 transcript:ENSONIT00000019279 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTLDMDAVLSDFVRSTGAEPGLARDLLEGKNWDLSAALNDYEELRQVHTANLPQVFNEGR
YYKQPETRDTPTHVSKIDRPCAQKQEDNAQEKRLSRGISHASSAIVSLARLQVASECTSE
QFPLEMPIYTFQLPDLSVYSEDFRSFIERDLIEQSTMMALEQAGRLNWWSTMCTSCKKLL
PLATTGDGNCLLHAASLGMWGFHDRDLMLRKSLYTMMKSGAERDALKRRWRWQQTQQNKE
SGLLYTEEEWEKEWNELLKLASSEPRTHLSKNGNTSGGVDNSEDPVYESLEEFHVFVLAH
VLRRPIVVVADTMLRDSGGEAFAPIPFGGLYLPLEVPPSRCHCSPLVLAYDQAHFSALVS
MEQRDQQREQAVIPLTDSEHKLLALHFAVDPGRDWEWGRDDNDNAKLANLILSLEAKLNL
LHNYMNVTWIRIPSETRAPLAQPESPTASAGEDVQSLAESMDSDRESVGSNSNVNTGKPS
KEKDKDKQRKDKDKSRADSVANKLGSFSKTLGIKLKKNMGGLGGLVHGKMNKSNSGSGRS
GENGGEKTKKKESKSTKGSKEDSGQSASSTSSEKATSPSPTDRDRPSSSSPTERQDSAGK
GSGDKTLENWKYSTDVKLSLNILRAAMQGERKFIFAGLLLTSHRHQFHEEMISYYLTNAQ
ERFSQEQDQKRKEAEKKPAVTNEVAVKKPEHESVFQRERSDSSPPESCSPILPHHTHTYN
NSQPPLGLKMQGRNSPTPPAPLASVPAPPLTPPPALHHVSHPAPTPAPYSSPSIGAKRPG
PVPVSAHYSHTPPIQRHSVIHLQDVNMQSSIFQDDPYKPVVGTLKTCATYPQQNRTLSSQ
SYSPARLSGVRTVNTIDSLSYNMPGEHKSHTYTNGFDAGDIQDCLEFADEDNSSHTWLNQ
DKTKGRSSGSPLYCFQQRRCKRENCSFYGRPETDNYCSYCYREEVKRRERESKMQRPV
Download sequence
Identical sequences I3KDR7
ENSONIP00000019262 ENSONIP00000019262 XP_013124041.1.78416

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]