SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000019303 from Oreochromis niloticus 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000019303
Domain Number 1 Region: 46-149
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.96e-30
Family Spermadhesin, CUB domain 0.00073
Further Details:      
 
Domain Number 2 Region: 246-357
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.75e-26
Family Spermadhesin, CUB domain 0.0012
Further Details:      
 
Domain Number 3 Region: 437-475
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000353
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 4 Region: 156-192
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000838
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 5 Region: 199-241
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000236
Family LDL receptor-like module 0.0019
Further Details:      
 
Domain Number 6 Region: 399-436
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000641
Family LDL receptor-like module 0.002
Further Details:      
 
Domain Number 7 Region: 361-397
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000113
Family LDL receptor-like module 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000019303   Gene: ENSONIG00000015342   Transcript: ENSONIT00000019320
Sequence length 867
Comment pep:novel scaffold:Orenil1.0:GL831602.1:177842:186776:1 gene:ENSONIG00000015342 transcript:ENSONIT00000019320 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALKTDCRQGVVCLLLLTGCFSASQRNENVYVSGISNACSDVAELLRASSGIITSPGWPF
QYPARMNCSWNIRARPGDAITISFQDFDLQGSHRCTSDWMSISSYRNLDGLRVCGSSLPP
PYISSQDHLWIHFHSDDSLTGKGFRLSYISGKPLASSCDVDQFHCSNGKCIPDWWRCNSM
DECGDNSDEEMCVDSPFSFQPCSLNQFPCLSRYTRIYTCLPHSLRCDGSIDCQDLGDEID
CDVPTCGELLRNFYGSFSSPNYPDFYPPGSNCTWLIDTGDHRKVILRFTDFKLDGTGYGD
YVKVYDGLEENPRRLLRVLTAFDSRAPVAVVSSSGQLRVHFYADKINAARGFNVTYQVDG
FCLPWEVPCGGNWGCYTEQQRCDGYWHCPNGRDELNCSSCQEDEFPCSRNGACYPRSDRC
NYQNRCPNGSDEKNCFFCQPGNFHCKNNRCVFESWVCDAQDDCGDGSDEESCPVIVPTRV
ITAAVIGSLICGLLLVIALGCTCKLYSLRMFERRSFETQLSRVEAELLRREAPPSYGQLI
AQGLIPPVEDFPVCSGSQASVLENLRLAVRSQLGFTSLRLPSSGRRSNLWRRLFTFSRSR
RSGSLALVSADLEDSAGTGSTGSSGSDLLSPDSDDTDTEGERGRGISAVGGPVSPLPQKT
PPPSAVEAVLSMTPSVTLTSGRDNDRPREALPPSSPVTIVTSSPDPECHSDTSDLSAPAA
SALQRLAQNLHRLARNLTRTSQNQQSQTWSNHSPLHQLETGRGGVEVTERRGSGEEDEDV
ELLIPVSDSDSSSSSLLVSDIRQPLLESYPSSTVNHAPRHHNGNSGRGGRDGPCEHCGMV
HTAQIPDACLEATGKTESSDDELLLLC
Download sequence
Identical sequences I3KDV8
ENSONIP00000019303 ENSONIP00000019303 XP_003459712.1.78416

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]