SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000019441 from Oreochromis niloticus 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000019441
Domain Number 1 Region: 58-177
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.000000012
Family Spermadhesin, CUB domain 0.0064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000019441   Gene: ENSONIG00000015451   Transcript: ENSONIT00000019458
Sequence length 323
Comment pep:novel scaffold:Orenil1.0:GL831304.1:1287427:1292379:-1 gene:ENSONIG00000015451 transcript:ENSONIT00000019458 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRVMERTFREQLFFLVLCLSVLKGDSRYIENNEITKDELYSFFNSELKREIPEELMYRRP
LRCLDMVAVEGQFTFTAERPQLSCAAFFMAEPNEVISVDYDSVDIDCIGGDFITVFDGWV
MKGEKFPSTHDHPLPLFERYVDYCDSGSLRKSVRSSQNVAMVFFRIHSAGSSFTLTVRKH
TNPFPCNVMSQSPEGSYTMVIPQQHRNCSFSIIYPVEISISEFSLGHYNHLPKRSMPGCA
ESGDFVQLLGGNGIDTSKLLPITDLCIAFTGPTHMKIGCDNTVVRMVSSGKFVNRVSFSY
RLLDSQELQTIKLNNVEDFCFNN
Download sequence
Identical sequences I3KE96
ENSONIP00000019441 XP_003455210.1.78416 ENSONIP00000019441

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]