SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000019455 from Oreochromis niloticus 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000019455
Domain Number 1 Region: 16-362
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.02e-120
Family Motor proteins 0.0000000000278
Further Details:      
 
Weak hits

Sequence:  ENSONIP00000019455
Domain Number - Region: 699-822
Classification Level Classification E-value
Superfamily Bacterial hemolysins 0.0863
Family HBL-like 0.042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000019455   Gene: ENSONIG00000015463   Transcript: ENSONIT00000019472
Sequence length 1063
Comment pep:novel scaffold:Orenil1.0:GL831318.1:571634:585192:1 gene:ENSONIG00000015463 transcript:ENSONIT00000019472 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSNVQSGGKREEKGRNIQVVVRCRPFNTMERKSSYGVIDCDQNRKEVMVRTGGMNDKAS
RKTYTFDMVFGPSAKQIEVYRSVVCPILDEVIMGYNCTVFAYGQTGTGKTFTMEGERSPD
EQFTWEEDPLAGIIPRTLHQIFEKLSENGTEFSVKVSLLEIYNEELFDLLSPTEDVSERL
QLFDDPRNKRGVVVKGLEEVTVHNKDEVYQILERGAAKRRTASTLMNAYSSRSHSVFSVT
IHMKEITLEGEELVKIGKLNLVDLAGSENIGRSGAVDKRAREAGNINQSLLTLGRVITAL
VEKRPHVPYRESKLTRILQDSLGGRTKTSIIATVSPSSSNLEETLSTLEYASRAKNIMNK
PEVNQKLTKRTLIKEYTEEIERLKRDLAATRDKHGVYLSSENYESMVAQITAHEEQITEY
NDKIAIMEEELKKVTELFVDSKARLEQCTADLDEKQQRLEETSRDLQETKVKLSEEEFIC
SELSSVQETLYDTAGQLLSTADASTSDVSGLHDKLDRKKKVEEHNREIQQSFAQQMEGSF
RDVQRCIQQHGDKQRHMLSSYSQAVDGLLMMNEAALKGALTTVESFVGGVRPLVAESVAR
CEEKVQQNEMLCLQDKESVLQLLEEHRRDMEEVLVVQTLMGLSAAKELNDSLRASVEKQR
ALADKAEAMKEMGVVFDSLVRELAALREATVQSLSALQAERNELEDKIRQAEEEIEQKDM
KETIQCLQDQLNLLTVKVKKKFTGLYSASRGLQKPLQSLQEDISRGCSTVEHQVSAQADL
LSSSASSLISSLRLTADESQQSLEEMSGCCSHIHSSVTGLLERDLEWSSRVKEHAEKRAE
EQLTLMRKVGSEAQDLRQSVEDRCSEQLRAAKVEISNHQQEVTRALTAVKDQTSIDWSAL
HEQRAELLQHVEASEQLVHSFLRDELQEDVPTGATPQRREFVYPRQLVKSRRRSELLESL
RRQQEELQAAMEAEEEEELEDEDKQSQTDPDSLEDDLSTCNESLATEPSFIDENLVFNES
KRVPFFKKKKGKKETKIPSRSKVSENEAESTPQRSRLPLRCQN
Download sequence
Identical sequences I3KEB0
ENSONIP00000019455 ENSONIP00000019455 XP_003455739.1.78416

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]