SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000019602 from Oreochromis niloticus 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000019602
Domain Number 1 Region: 371-531
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.02e-35
Family SPRY domain 0.00048
Further Details:      
 
Domain Number 2 Region: 9-83
Classification Level Classification E-value
Superfamily RING/U-box 0.00000000000000508
Family RING finger domain, C3HC4 0.0095
Further Details:      
 
Domain Number 3 Region: 142-182
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.0000000534
Family B-box zinc-binding domain 0.0039
Further Details:      
 
Weak hits

Sequence:  ENSONIP00000019602
Domain Number - Region: 188-252
Classification Level Classification E-value
Superfamily Bacterial hemolysins 0.0214
Family Hemolysin E (HlyE, ClyA, SheA) 0.064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000019602   Gene: ENSONIG00000015577   Transcript: ENSONIT00000019619
Sequence length 545
Comment pep:novel scaffold:Orenil1.0:GL831380.1:422137:426025:-1 gene:ENSONIG00000015577 transcript:ENSONIT00000019619 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEDAEESRMVEMLMCPVCRDIFKDPRQLPCGHSMCMTCLEGLMAHSSDSDVPFKCPDCRE
HFSQVVTVQKSYALARIAEDFRLSRRTRVPTRCEKQTKCVYCDYCPEKNILAVKTCTKCE
VSLCKEHVKDHQELPVFTGHPLVGPLSDLAERRCPQHEDEVLRYNCKSSRRYICSICTLE
GKQLNVATEASTVLRRQLTMLRQFKEYMDQHFKMLMDQITESSNTVRKLQEDIHHNNQTL
TEALDEQQNRVHDIYSTIAGNEGSIFILSQANFLLSVKYPSIESLVYHPMKSYRPKETED
QGRTRMRGVQFVWLASIKVFRVNLLIYWMKIDKMCYNLETMDLTSVVCIVKIYKVPYNGL
LKSFNSVSRAVMLDLDTVNHVLGVSADLKTAERVKAKLDYPNSNSRFDEAPQVLSSQCFS
SGVHVWEVEAEGHWDIAVSYKSIQRKCKETSAFGNNTESWSLVHKGKGNLFACHNKTKTP
VSRALQSSRIAVVVNFEEGSISFSAVDSTVTQLHEFKAELRQPVCLGLGLHHVDPPSRAS
IVKAS
Download sequence
Identical sequences I3KEQ7
ENSONIP00000019602 ENSONIP00000019602

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]