SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000019775 from Oreochromis niloticus 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000019775
Domain Number 1 Region: 711-877,927-1070
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 5.53e-80
Family Protein kinases, catalytic subunit 0.00000202
Further Details:      
 
Domain Number 2 Region: 105-145
Classification Level Classification E-value
Superfamily UBA-like 3.51e-17
Family UBA domain 0.00079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000019775   Gene: ENSONIG00000015712   Transcript: ENSONIT00000019792
Sequence length 1173
Comment pep:novel scaffold:Orenil1.0:GL831347.1:685910:702360:1 gene:ENSONIG00000015712 transcript:ENSONIT00000019792 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRPKTFPAAPYVGNTRQRLQEIKEGLKQPAKLVSQALHGSSSRNEGGKGADSKSGKDTTS
RQQQLRPPQKFNNYQNALREIRKSLKPFESGSTSGSGHPAGAGEVNRQMLQELVNAGCDK
EMAIRALKQTGSRNIEAALEYISKMSYLDPRNELIVRVIKQTSPGKAGMPNAMDHRPSLE
ASGEAGAMPPYHQLGNSMYDGAKGYGPEGEMPRPYMNAPPVMNYMMPPSGAAQVTGMGNP
LGRPPSMGNYPSVMATQSNPGNTMYPPGAQQKGYPGSMEQHGPMMSYNVPGQPLQLQPQP
PGGPVPGPHYDYSHARTHMMESAGYGVKRTPSFQNKMPPPPMSPTDNYVNMQGKGGMGQN
GPAGGGGGYPANLYLAPHSHPRQASPTSHQVHMMSRSPGAVAMVPDFSDLPQGLMTPSRA
SLNLDLYEHPWAGPPGSEGAPQSRQPQPQGPFRGEVRVPSRTNSFNSRSAGPNAVRPGMA
APPANGKQEPSLGPPNTITAVTSPPIQQPVKSIRVMRPEPKTAVGPCHPGWMTAQAQDAS
EPLPYMPEETYPLEPAQEPRCPPPPYPKNLLMSGAAGETGALEGAAGVCGAQDLNNPAAR
STHSGSGGSGKAEESQPVKEKTKMGKGEKTVKDKKQIQTSPVPVRKNGQDEEKRESRIKS
YSPFAFKFYMEQHIENVMKTYHQKLNRRLQLEQEMSKAGLSEAEQEQMRKMLYQKESNYN
RLRRAKMDKSMFVKIKTLGIGAFGEVCLTRKVDTGALYAMKTLRKKDVLNRNQVAHVKAE
RDILAEADNEWVVRLYYSFQDRDSLYFVMDYIPGGDMMSLLIRMGVFPELLARFYVAELT
LAIESVHKMGFIHRDIKPDNILIDLDGHIKLTDFGLCTGFRWTHNSKYYQKGSHIRQDSM
EPSDFWDDVSNCRCGDRLMTLEQRANRQHQRCLAHSLVGTPNYIAPEVLLRKGYTQLCDW
WSVGVILFEMLVGQPPFLAPTPTETQIKVINWESTLQVPAQVKLSPEAVDIIGRLCCSAE
DRLGANGAGEIKAHPFFSQVDFSSNLRQQPAPYRPKIAHPMDTSNFDPVEEEGGPGAWSD
SGDSTRALDALCSPHGKHPEHAFYEFTFRRFFDDNGCPFRYPKPLETSEVSLSIPGAIGM
GPDEEEEQEEEDEDEEDEEEEGEQGEGCEPVYV
Download sequence
Identical sequences I3KF80
XP_005475381.1.78416 ENSONIP00000019775 ENSONIP00000019775

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]