SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000019819 from Oreochromis niloticus 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000019819
Domain Number 1 Region: 253-294
Classification Level Classification E-value
Superfamily Frizzled cysteine-rich domain 0.0000916
Family Frizzled cysteine-rich domain 0.007
Further Details:      
 
Weak hits

Sequence:  ENSONIP00000019819
Domain Number - Region: 319-409
Classification Level Classification E-value
Superfamily Bacterial hemolysins 0.00654
Family Hemolysin E (HlyE, ClyA, SheA) 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000019819   Gene: ENSONIG00000015747   Transcript: ENSONIT00000019836
Sequence length 572
Comment pep:novel scaffold:Orenil1.0:GL831239.1:55511:85437:1 gene:ENSONIG00000015747 transcript:ENSONIT00000019836 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKSLLALCVVWTVVVLSVSGTAEQKLNNCNEVRAAYSSKGFNVNDVPNKGINGGHLKVCP
QGYSCCTVEMEEKLSQQSHTEIKAPVSKLSTSLQSTFKQRHDHFDKFFRELLKNAEISLD
SMFVKTYGMMYVQNSELFKNFFQSLTQYYASGSAAVNLDSMLSDFWADLLERMFRLVNVQ
YEFSDTYMECVSRHTEELQPFGDVPRKLRIQLTRSFIAARTFVRGLALMPEVANKVSTVS
ASPSCVRAAMKMLYCPYCSGQVALKPCQNYCLNVMRGCLANQADLDTEWNNFLDAMHSLA
ERLEGPFNFESVMDPIDVKISEAIMNMQENSMQVSQKVFQGCGMPKTSTAFRSKRSVKDS
TFTSRFRPYSPEARPTTAAGTSLDRLTSEVKKKLKHAKKFWSTLPETVCVSEGIAAGDEC
WNGTAKSRYESDVIGSGLANQISNPDVDVDITKPDTVIRSQIAVLKEMTSRLKAAHSGID
ITAESDDDGSGDESGSGCDGPNCDIYFSVPPTSDKEGGGKAAGGKAVGGSAAAGSPRVNP
VQSNNSAGVTSRGSMALALCGLALALLAPHLR
Download sequence
Identical sequences I3KFC4
ENSONIP00000019819 ENSONIP00000019819 XP_013130885.1.78416

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]