SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000019922 from Oreochromis niloticus 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000019922
Domain Number 1 Region: 56-311
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 4.86e-95
Family Protein kinases, catalytic subunit 0.000011
Further Details:      
 
Domain Number 2 Region: 647-761
Classification Level Classification E-value
Superfamily KA1-like 8.5e-18
Family Kinase associated domain 1, KA1 0.0016
Further Details:      
 
Weak hits

Sequence:  ENSONIP00000019922
Domain Number - Region: 324-373
Classification Level Classification E-value
Superfamily UBA-like 0.00113
Family UBA domain 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000019922   Gene: ENSONIG00000015826   Transcript: ENSONIT00000019939
Sequence length 761
Comment pep:novel scaffold:Orenil1.0:GL831214.1:2142142:2169453:1 gene:ENSONIG00000015826 transcript:ENSONIT00000019939 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSRSALPSGNDRSSGDHHVSLGASRSDKATSQSSRSLGARCRNSIASCSDEQPHIGNYR
LLKTIGKGNFAKVKLARHILTGREVAIKIIDKTQLNPTSLQKLFREVRIMKGLNHPNIGK
LFEVIETDKTLYLVMEYASGGEVFDYLVSHGRMKEVEARAKFRQIVSAVHYCHTKNIVHR
DLKAENLLLDADANIKIADFGFSNEFTLGNKLDTFCGSPPYAAPELFQGKKYDGPEVDVW
SLGVILYTLVSGSLPFDGQNLKELRERVLRGKYRVPFYMSTDCEGILRRFLVLNPAKRCT
LEQVMKDKWINAGYEGDELKPHIEPVEDYSDPARIEVMVGMGFTPEEIKDSLLNQKYNEV
TATYLLLGRKGDDGSDARTASSLSLARVRPSPITNGTNKHSSATGSSSSSTSSSHSKTQR
SASTYHRQRRHSDFCGPSMPVMHPKRSPTSTGDRELREGRMPPRKASCSVMGSRSLPPSS
PMVSSANNPNKSEIPDRRKDMTATTNNIPGSAMTRRNTYVCTDRSGTDRHSLLQNGKDNS
SLGHRMPAASPSTLSIAAAGAAGSSSSSDRCRLTRGSTIRSTFHGGQLRDRGPPVYSAPP
TSPTLSHHDASPLTHARTRATSNLFTKLTSKLTRRVTNESEGIRRFAVTSCHLPGYQKAS
EPRAVGRGWDLRGGGRRDPAEVVLALREAALGCGCQVHHAGPFLLSCTHGVAGGRVAFEA
EVCHLSTGTSETSNGVRYTRLWGAPLAFRDIATQISKDLEL
Download sequence
Identical sequences I3KFM7
ENSONIP00000019922 ENSONIP00000019922

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]