SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000019966 from Oreochromis niloticus 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000019966
Domain Number 1 Region: 164-447,554-659
Classification Level Classification E-value
Superfamily Cysteine proteinases 1.3e-71
Family Ubiquitin carboxyl-terminal hydrolase, UCH 0.0025
Further Details:      
 
Domain Number 2 Region: 4-72
Classification Level Classification E-value
Superfamily UBA-like 1.28e-24
Family UBA domain 0.00054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000019966   Gene: ENSONIG00000015857   Transcript: ENSONIT00000019983
Sequence length 1169
Comment pep:novel scaffold:Orenil1.0:GL831214.1:2501477:2535315:-1 gene:ENSONIG00000015857 transcript:ENSONIT00000019983 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTVEQNVLQQHSQKHQQTLLNQLREVTGTTDVQLLQQALQVSNGDLGEAVAFLTEKNAKV
PQQDETTYYQTSQVASDRYISVGSQADTNVIDLTGDDKDDLQRAIALSLEESNRAFRETG
ITDEEQAISRVLEASIAENKASLKRTHTEVWSDSPNPHDRKRIDNCPVGLKNVGNTCWFS
AVIQSLFNLLEFQRLVLNYSPPARVHDLPRNQKEHRNLPFMQELRNLFSLMVGSKRKYVD
PSRAVEILKDAFKSSESQQQDVSEFTHKLLDWLEDAFQMKAEEDREGEKPKNPMVELFYG
RFLAVGVHEGKKFENTEMFGQYPLQVNGFKDLHECLEAAMIEGEIESLHSAENSARSGQE
HWFTELPPVLTFELSRFEFNQALGRPEKIHNKLEFPSMLYMDRYMDRNREITRIKREEIR
RLKEHLTLLQQRLERYLSYGSGPKRFPLADVLQYAMEFASSKPVCTSPVEDIDTSAPPGG
TTGQQLPPPSTAEQDSLPPLESSGLASGPATAPSAAQQQRVPIHKPFTQSRLPPDLPMHP
APRHITEEELRVLEGCLHRWRSEVENDTRDLQGSITRIHRTIELMYSDKSMMQVPYRLHA
VLVHEGQANAGHYWAYIYDPHQRCWMKYNDISVTKSSWEELVRDSFGGYRNASAYCLMYI
NDKKPFLTEEEFDKETGQILSGMDKLPPDLKQYVKEDNEQFDKEIEEWDIMQARKAQQEK
LALATAAAAAASAASSTSTSSSSPQPMSIESSPPDNAVPQQDPEYMEQPSPTNDSKHLQE
DTERAISRAAAEQEEKSPEALLNASLPPPTSPQPEVQMNTPVTPPPDLVTEDESPGQRTV
EVAIPNVGTFVIESEEGGYDDEAMMTPDMQGVIMAIGKSSSVYEKNGPEAAFFKAIKLEY
ARLLRFAQEDTPVENDYRLQHIIVYFIQNQAPKKILERTLLTQFADRNLAFDERCKSIMN
VARAKLDLIKPEEVNMDEYEIWHQDYRNFRESTILMVTGLELFQKTNYVEALMYLIYAYQ
YNKELLLKGLYRGHDEELLGHYRRECLLKLNEQAAAMFESGEEPEVTTGLGIMNELVVPC
IPLLLVHEAERDLLAVEDMRNRWCSYLGQEMESNLQEKLTDFLPKLLDCSTEIKSFHDPP
KLPTYSTLELCERFSRIMAALGRVPTEGR
Download sequence
Identical sequences I3KFS1
ENSONIP00000019966 XP_005454646.1.78416 ENSONIP00000019966

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]