SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000020270 from Oreochromis niloticus 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000020270
Domain Number 1 Region: 53-160
Classification Level Classification E-value
Superfamily SRCR-like 2.09e-38
Family Scavenger receptor cysteine-rich (SRCR) domain 0.00024
Further Details:      
 
Domain Number 2 Region: 320-421
Classification Level Classification E-value
Superfamily SRCR-like 2.09e-32
Family Scavenger receptor cysteine-rich (SRCR) domain 0.00022
Further Details:      
 
Domain Number 3 Region: 430-546
Classification Level Classification E-value
Superfamily SRCR-like 7.19e-26
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0017
Further Details:      
 
Domain Number 4 Region: 200-299
Classification Level Classification E-value
Superfamily SRCR-like 2.09e-21
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0098
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000020270   Gene: ENSONIG00000016093   Transcript: ENSONIT00000020287
Sequence length 766
Comment pep:novel scaffold:Orenil1.0:GL831199.1:3002690:3049743:-1 gene:ENSONIG00000016093 transcript:ENSONIT00000020287 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRVIQNLYARTAVLLVLLRLSVAQYEHLGYPPGYPYPEQEEYTAPQLDPDTPRIQLRLAG
QKRKHNEGRVEVFYNNQWGTVCDDDFNIHAAQVVCRELGYVEAVSWLPSSKYGKGEGPIW
FDNVHCTGKEKTLAQCQSNGIGISDCKHSEDVGVVCSDKRIPGFKFLNTLPNHVENLDIH
VEDVQIRAILSSYRKRIPVMEGYVEVKDGGKWKQICNKDWTQFNSRVICGMFGFPGERKY
NPRVYKMFARRRKPTYWDYSVNCTGNEAHLSSCKLGQAVLEKSNGTCPRGLPVVVSCVPG
KDFAPTLMTGFRKAFRQEQPLVRLRGGAIVGEGRVEVLKNGEWGTICDDKWNLLSATVVC
RELGFGTAKEALSGGRLGQGMGPVHMNEVECSGFEKSITECSFNKEALGCSHEEDAAVRC
NVPKMGFQERLRLSGGRNPYEGRVEVLVERNGSLVWGTVCSEGWRTMEAMVVCRQLGLGF
ASNAFQETWYWSGEVSADAVVMSGVRCSGTEMSLSHCLHHGAHLSCPKGGGRYAAGVSCS
ETAPDLVLNPQVVEQTTYMEDRPMFMLQCAYEENCLSSTSSEVPANTYRRLLRFSSQIHN
NGQSDFRPKADKHSWVWHDCHRHYHSMEVFTIYDLFSLNGTKVAEGHKASFCLEDSECDE
GIEKRYECANFGDQGITVGCWDTYRHDIDCQWVDITDLKPGDYIFQIIINPNYEVPESDY
TNNFTKCRCRYDGHRVWMYSCHNGGSLSSETEQTFPGLHSNQVTHR
Download sequence
Identical sequences I3KGM5
ENSONIP00000020270 ENSONIP00000020270

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]