SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000020692 from Oreochromis niloticus 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000020692
Domain Number 1 Region: 2285-2355,2551-2833
Classification Level Classification E-value
Superfamily Hect, E3 ligase catalytic domain 1.57e-66
Family Hect, E3 ligase catalytic domain 0.00013
Further Details:      
 
Domain Number 2 Region: 2414-2499
Classification Level Classification E-value
Superfamily PABC (PABP) domain 2.35e-23
Family PABC (PABP) domain 0.0000467
Further Details:      
 
Domain Number 3 Region: 384-518
Classification Level Classification E-value
Superfamily RCC1/BLIP-II 0.000000000484
Family Regulator of chromosome condensation RCC1 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000020692   Gene: ENSONIG00000016431   Transcript: ENSONIT00000020710
Sequence length 2840
Comment pep:novel scaffold:Orenil1.0:GL831539.1:250156:281138:1 gene:ENSONIG00000016431 transcript:ENSONIT00000020710 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTSIHFVVHPLPGTEDQLNDRLREVSEKLNKYSYNSHPHLSLLEQATLKQCVVGPNHAGF
LLEDGRVCRISFAVQPDRLELSKPDGSDGSKLSSGSGTGRSSRPGRTSDPPWFLSGSDTL
GRLAGNTLGSRWSSGVNGGSGGGGSGGGAGGGGAGGGSSGGGGGGGGGGGTSGRSSTAAR
DSRRQTRVIRTGRDRGSGLLSSQPQPVIPASVIPEELITQAQVVLQGKSRSVIIRELQRT
NLDVNLAVNNLLSRDDEDGDDGDDTASESYLPGEDLMSLLDADIHSAHPSVIIDADAMFS
EDISYFGYPSFRRSSLSRLGSSRERDSELLRERESVLRLRERRWLDGASFDTERGSTSRE
GEPSLDKKSIPVQSPVSLGEELQWWPDKDGVKFVSIGAMFSELVAVSSKGELYQWKWSES
EPYRNPQNPAIHHPRISFLGLANEKITLLSANSIRATVATETNKVATWVDETLSTVASKL
EHSAQAFPELQGERMVSLHCCALYTCAQLENSLYWWGVVPFSQRKKMLEKARAKNKKPKS
SAGISSIPNITVGTQVCLRNNPLYHAGAVAFSVSAGIPKVGVLLESVWNMNDSCRFQLRS
PESLKNMEKTTKTQEIKTESKPELVKTEMGPPPSPASTCSDTSSIASSASLPYKRRRSTP
APKEEEKVNEEQWPLREVVFVEDVKNVPVGKVLKVDGAYVAVKFPGTSSSMSNQSTAAPT
DSDPSSLLQDCRLLRIDELQVVKTGGTPKVPDCFQRTPKKLCIPEKAEILAVNVDSKGVH
AVLKTGNWVRYCIFDLATGKAEQENNFPTSNLAFLGQSERNVAIFTAGQESPIILRDGNG
TIYPMAKDCMGGIRDPDWLDLPPINSLGMGVHSLANLPSNSTIKKKAAIIIMAVEKQTLM
QHVLRCDYEACRQYLVNLEQAFLLDQGSQALGALLGHRCDGNRNILHAAVSVCFPVSNKE
TKEEEEAERSERNTFAERLSAVEAIANAISVVSSNSSGNRTGSSSSRGLRLREMMRRSLR
AAGLGRHESGPSSSDHQDPVSPPIAPPSWVPDPPPMDPDGDIDFILAPAVGSLTTASTGS
SQGPSTSTIPGPSTEPSVVESKDRKANAHLILKLMCDSVVLRPHLRELLSAKDARGMTPF
MLAVSGRAYPAAITVLEAAQKMAKVGDPGIAEKDDADSVFMEMICPSGTNPDDSPLYVLC
CNDTCSFTWTGAEHINQDIFECRTCGLLESLCCCTECARVCHKGHDCKLKRTSPTAYCDC
WEKCKCKTLIAGQKAARLDLLYRLLTTTNLVTTPNSRGEHILLFLVQTVARQSVEHCQYR
PPRIREDRNRKAANAEDSDMPDHDLEPPRFAQLALERVLQDWNALKSMIMFGSQENKDPL
SASSRIAHLLPEEQVYLNQQSGTIRLDCFTHCLIVKCAPDITFIDTLLGTLVKELQNKYT
PGRREEAINVTRRFLRSVARVFVILSVEMASSKKKNNFIPQPIGKCRRVFQALLPYAVEE
LCNVAESLIVPVRMGIARPTAPFTLASTSIDAVQGSEELFSVEPLPPRPSPDQSSSSSQT
AASYIIRNPQPRRSSQSQPVRGRDEEQDDIVSADVEEVEVVEGVAGEEDHHDDQEEQGEE
NAEAEGQHDEHDEDGSDMELDLLAAAETESDSESNHSNQDNASGRRSVVTAATAGSEAGA
SSVPAFFSEDDSQSNDSSDSDSSSSQSDDVDQETFLLDEPLERTTNASHANSAAQAPRSM
QWAVRNTPSQRTPGSAPSSTSTPAASSTGLIYIDPTNLRRSSAISSSAAAAAAALEASNS
SSYLTSASSLARAYSIVIRQISDLMSLIPKYNHLVYSQYPAAVKLTYQDAVNLQNYVEEK
LIPTWNWMVSIMDSTEAQLRYGSALSSAGDPGHPSHPLHASQHSARRERMTAREEASLRT
LEGRRRAATLLTARQGMMSARGDFLNYALSLMRSHNDEHSDVLPVLDVCSLKHVAYVFQA
LIYWIKAMNQQTTLDTPQMDRKRNREILELGLDNEDSEHENDEDTNQSSTLQDKDEDPVP
AETGQNHPFFRRSDSMTFLGCIPPNPFDVPLAEAIPLADQPHLLQPNARKEDLFGRPSQG
LYSSSYMATKGLAEATMDRNCLEVNMGSSLPSPSQILPTKMSYSANLKNVMSMETGQRST
ENQSLAEQELEASKPGPSPHDLAAQLKSSLLAEIGLTESDGPPLPSFRPHCSFMGMMISH
DMLLGRWRLSLELFGRVFMEDVGAEPGSILTELGGFEVKESKFRREMEKLRNLQSRDLAL
EVDRDRDQLIQQTMRQLNTHFGRRCTTTPMAVHRVKVTFKDEPGEGSGVARSFYTAIALA
LLSNEKLPNLDCVQSVSKGMQASSTCHHDYNSNLMQRLRNRDRERERRSGGLRAGSRRDR
DRDSRRQLSIDTRPFRPSSEGNPSDEPDPLPAHRQALGERLYPRVHAMQPAFASKITGML
LELSPAQLLLLLASEDSLRARVEEAMELLIAHGRENGADSILDLGLPEAPEKSQQQENRK
RHGSTRSVVDMELDDPDDGDDNAPLFYQPGKRGFYSPRPGKNTEARLNCFRNIGRILGLC
LLQNELCPITLNRHVIKVLLGRKVNWHDFAFFDPVMYESLRQLIRHSQAGEAEAVFAAMD
LAFAIDLCKEEGAGQVELLSGGVNMPVTPLNVYEYVRRYAEHRMLVVAEQPLHAMRKGLL
DVLPKNALEDLTAEDFRLLVNGCGEVNVQMLISFTSFNDESGENADKLLQFKRWFWSIVE
KMSMTERQDLVYFWTSSPSLPASEEGFQPMPSITIRPPDDQHLPTANTCISRLYVPLYSS
KQILKQKLLLAIKTKNFGFV
Download sequence
Identical sequences I3KHU7
ENSONIP00000020692 ENSONIP00000020692

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]