SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000020774 from Oreochromis niloticus 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000020774
Domain Number 1 Region: 50-231
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.08e-16
Family G proteins 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000020774   Gene: ENSONIG00000016498   Transcript: ENSONIT00000020793
Sequence length 240
Comment pep:novel scaffold:Orenil1.0:GL831373.1:807096:808802:1 gene:ENSONIG00000016498 transcript:ENSONIT00000020793 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGSLFSKAQDRSNVTKDRQLVAANMSCWAHGLHCIRRQHTDEAKTGRHTGTTVNFVLLGA
AGTGKSASGNTILGKKHFISRPSSKPVTTKCQNGQTKINDLHVRVIDTPDIFDDEIGSSV
RNKHMNRCKELCESGPCVYVLVMHVSRFTDGERDIMETLEEDFGSEVSGRTIILFTRGND
LQQAGMGLEDFLHSCQPDLKKMVEKCGNRCVLFENNKSGSDQVEKLMEKVNTILEDQKSL
Download sequence
Identical sequences I3KI29
XP_003457375.1.78416 ENSONIP00000020774 ENSONIP00000020774

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]