SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000020978 from Oreochromis niloticus 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000020978
Domain Number 1 Region: 211-274
Classification Level Classification E-value
Superfamily Homeodomain-like 1.88e-19
Family Homeodomain 0.0035
Further Details:      
 
Domain Number 2 Region: 95-161
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0000000000000691
Family LIM domain 0.015
Further Details:      
 
Domain Number 3 Region: 62-93
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.000000163
Family LIM domain 0.026
Further Details:      
 
Weak hits

Sequence:  ENSONIP00000020978
Domain Number - Region: 157-186
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0797
Family LIM domain 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000020978   Gene: ENSONIG00000016653   Transcript: ENSONIT00000020997
Sequence length 347
Comment pep:novel scaffold:Orenil1.0:GL831261.1:836653:843546:1 gene:ENSONIG00000016653 transcript:ENSONIT00000020997 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVDTMSEEERPSTEVVFTQLQQGHIYSDTGSSGPDDIFEEDSYSPSSLSSSSSSAVPTEA
CVQGKPVCTSCGLEIVDRYLLKVNNLCWHVRCLSCSVCKTSLGRHVSCYIRDKEVFCKLD
YFRRYGTRCARCGRNIHSSDWVRRARGSTFHLACFSCTSCKRQLSTGEECGLLENRVFCR
PHYDIMIENLKRAKENKQPKNEEMADKDDLSILPKPAKRARTSFTVDQLQVMQTQFAKDN
NPDAQTLQKLADRTGLSRRVIQVWFQNCRARQKKHINPNPAQSTMMTSLAPGQLSPPLMD
DLQYTTYISPDAPLLTTLTYMDVQTPDPLLLQPHMSHSLTQLPVSHA
Download sequence
Identical sequences I3KIN3
ENSONIP00000020978 ENSONIP00000020978 XP_005458019.1.78416

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]