SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000020995 from Oreochromis niloticus 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000020995
Domain Number 1 Region: 234-348
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 5.89e-38
Family Spermadhesin, CUB domain 0.00023
Further Details:      
 
Domain Number 2 Region: 75-186
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.44e-33
Family Spermadhesin, CUB domain 0.00088
Further Details:      
 
Domain Number 3 Region: 400-512
Classification Level Classification E-value
Superfamily Frizzled cysteine-rich domain 5.49e-28
Family Frizzled cysteine-rich domain 0.00022
Further Details:      
 
Domain Number 4 Region: 351-389
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000000236
Family LDL receptor-like module 0.00082
Further Details:      
 
Domain Number 5 Region: 191-228
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000314
Family LDL receptor-like module 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000020995   Gene: ENSONIG00000016667   Transcript: ENSONIT00000021014
Sequence length 514
Comment pep:novel scaffold:Orenil1.0:GL831207.1:882236:886424:1 gene:ENSONIG00000016667 transcript:ENSONIT00000021014 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
WGVVVVSAAVLLLLAALGLMLVLILTHKKPGSGGSGLQHAGDGLSQTLPTVPINRSKEDS
TAAPQPARIPPSEPSCGGVLTDTEGSFSSPNHPASYPPNSLCVWVIQVLPPYVVQIHVSS
LTVEGPSPCLFDWVEVQEQIEQTSVVTRFCGNVAPPTVNTNSSTVWVTFHSDGSIAGNGF
TAQYRAVLPGHKSCSREEFMCDGGRCLLPVSVCDGHPNCHDQMDEANCSHKHKECGGQKI
GPYGYLASPNHPGPYPHQQLCIWHISVEEGHVITLSFRNFSLETQDVCEFDYVEVHDSVS
TGAGRVLGRFCGTTFPPELTSSGPHMTVVFVADEGVADSGFNATYQAVSVLGRTCGPRQF
ACSTGECVQQQWLCDGWNDCPDGADEQGCGNSTYPPFTSSCEHIEVEMCRGLSYNFTSFP
NIWLSIADQREAATLLGQYRVLMELACFEPLQRLVCGMFLPQCSPQGGVLQPCRSVCSSA
EQQCSQALDLFSFSWPFNCHLLPDSQDPLECSLP
Download sequence
Identical sequences I3KIQ0
ENSONIP00000020995 ENSONIP00000020995

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]