SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000021020 from Oreochromis niloticus 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000021020
Domain Number 1 Region: 94-349
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.29e-92
Family Protein kinases, catalytic subunit 0.0000133
Further Details:      
 
Weak hits

Sequence:  ENSONIP00000021020
Domain Number - Region: 375-416
Classification Level Classification E-value
Superfamily UBA-like 0.0471
Family UBA domain 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000021020   Gene: ENSONIG00000016684   Transcript: ENSONIT00000021039
Sequence length 1305
Comment pep:novel scaffold:Orenil1.0:GL831207.1:1006527:1043534:1 gene:ENSONIG00000016684 transcript:ENSONIT00000021039 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTQGGGVPAMRAAHGCLLFPQRGEKMAAVSSGGAAGSAAAGITHSARPTHAGMGSQNRAQ
PSSGISHSGRTNTATGCITNPGHTSVPRPPPARVGHYEIERTIGKGNFAVVKLATHIITK
AKVAIKIVDKTQLDEENLKKIFREVQIMKLLKHPHIIRLYQVMETERMIYLVTEYASGGE
IFDHLVAHGRMAEKDARKKFKQIVAAVHFCHCRSIVHRDLKAENLLLDHNLNIKIADFGF
SNMFSRGQLLKTWCGSPPYAAPELFEGKEYDGPKVDIWSLGVVLYVLVCGALPFDGSTLQ
NLRARVLSGKFRIPFFMSTDCEYLIRHMLVLEPSRRLTMEQICKNKWMRQGDPDPEFDRL
IAECEQVKTEREMELINEQVLMAMCEMGLDRERTLQSLQTDAYDHYSAIYSLLADRLKKH
KTLRVAQPTLRPISYPLNAVQTDPQGNPVSMTVPHVQLINPENQIVEPDGSMALDSDEGE
EPSPEAMARYLSMRRHTVGVPDQRTEMQEDLQKLPPGFPRGALPQPPFIPLAPTMGQMHT
LMPTQSLQPTQQLEYKEQSLLQPPTLQLLNGMGPLGRRASDGGANIQLHAQLLKRPRGPS
PLVTSPHPIPAVAPVDEEGSDGEPDQEAVQRYLANRSKRHTTHTLTSTSHGEPSAESQRP
QGPRQRVGWVPDTHTRSSYKDCNTLHLPMERFSPVRRFSDGAATIQAFKAHLENSSLIKQ
LKQECEQLQKMYAVQQDEKLLEHTQQQHILYQQEQQILHQQIQGLSLGHGESQPSHLTHQ
LQRLRIQPSSPPPTQPSNHLFRQPNQSSPPGSVGLMQGHGQSSVQYQHGAPAMYQGQSGS
PPPTGLPRVSLPTNPQAASARPTVPLAQGVPQQQQVTIQVQEVELGGGAQRQSNFLSTPG
GHRVLGKQLSADNAESHSRSLGRFTSGYDQAQFNPHLYSGDAASRGASGVVGSYSPYLQG
ASLKVPGLEGYQTGAVGTNNYGAPSTLQQALLSPTPLDYRPPQQHVTPTLQGLLSPRHSL
TGHADPRLPPQDLAALLKRQSPRPCPAPPTPPSGAPQEYGDMLLLRQLGPGESLEPQVPQ
GASGGQHYHHLLQIRPPEVQQQQAPCPSLPHSESMEEDEVPASYHHPHEGLLAKTGEGHE
LLGPPRGGTPPYTSPTHRHGGYIRTGTGNRESEHVECRPQGQAMEVPDHNGVGYSRGPQG
EVYRSRGQLQRHHTIQTCDDAYDQADPMSGMSLLAGKALSSARMSDILSQTSLTGSQQLH
QREESVCDVEGELHAAACYPSSCTSDMLLSYKPPDLQYSMEQAGV
Download sequence
Identical sequences I3KIS5
ENSONIP00000021020 ENSONIP00000021020

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]