SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000021090 from Oreochromis niloticus 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000021090
Domain Number 1 Region: 24-93
Classification Level Classification E-value
Superfamily UBA-like 0.00000306
Family UBA domain 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000021090   Gene: ENSONIG00000016739   Transcript: ENSONIT00000021109
Sequence length 494
Comment pep:novel scaffold:Orenil1.0:GL831137.1:2572878:2590653:-1 gene:ENSONIG00000016739 transcript:ENSONIT00000021109 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAKKNSQRDTSGVVFDTRSKMVMSQGGTAERMKEKISAVRAVVPNKSNNEIVLVLQHFEN
CVDKAVQAFLEGSAVEILKEWNVTGKKKPKKKKKPKPQPEAPAEPAPPEATSPEEGKDEL
NGFHANGSVMDGESLDSLSEHLDSASLDAAELDSEPATSETTGAEAESQGSAPSPISQPG
GRNHQAPRGNKSRQRPNSNSHHPPASLASNTDEQGSSGVKKMASNIDRSVKDLQRCTASL
TRYRMVVKEEMDSSVKRMKQTFAELQSCLMDREVTLLGEMDKVKAEAMMILDARQKRAEE
LRRLTDKSASMSEEQLTELRADIKHFVSERKYDEDLGKALRFTFDLEPLKTSIGGFGSVY
HPRTGYSNRSRCSSTSSSVASPTLPETPAPTQIQSNYPSETRPPPAKQIFQGNRRTFHGQ
GYHSGGPRYNGGSYNDRNAGRANHRHQNDGASSGPTSQHSSNSRGPSHSSTSSHNQDRPS
HNGLPQRVPRTHGP
Download sequence
Identical sequences I3KIZ5
ENSONIP00000021090 XP_003439141.1.78416 ENSONIP00000021090

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]