SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000021099 from Oreochromis niloticus 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000021099
Domain Number 1 Region: 589-778,872-1190
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.04e-71
Family Tandem AAA-ATPase domain 0.028
Further Details:      
 
Domain Number 2 Region: 326-347
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.0000183
Family CCCH zinc finger 0.0052
Further Details:      
 
Weak hits

Sequence:  ENSONIP00000021099
Domain Number - Region: 192-243
Classification Level Classification E-value
Superfamily UBA-like 0.000613
Family UBA domain 0.026
Further Details:      
 
Domain Number - Region: 370-404
Classification Level Classification E-value
Superfamily UBC-like 0.0994
Family UBC-related 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000021099   Gene: ENSONIG00000016747   Transcript: ENSONIT00000021118
Sequence length 1432
Comment pep:novel scaffold:Orenil1.0:GL831226.1:385514:394069:1 gene:ENSONIG00000016747 transcript:ENSONIT00000021118 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNARRRGGKPNRGGGRFNKRGGGGGGNRKGGTRLWDDGDDFHLYFGPSHFSRSSKGRGGG
AHAGGRDGGRGGKKARDRDRDGNSSSKALPRSLMSTRMHSKVSDCIRPEVSSMPLQKIFM
TNENQEQLKELLRNLQTQDSDELYDDSGSDYSGLDEEEEEEFDELDYREEGQFWATNDEP
VEKAESPAFDPEYEDEEPCPEPVISLFAIGKLCRYGFDRERSKQALEAGGGEFGATLEQL
LQQIFTERYGQKAVSTDGLDEVPLDECINQREEEALALAAIYGERFSERIANAVWTVTLD
LSFLSRSPVKKGGVVGGGAPNIGDVCKFYMRGKGCRNGDKCRFKHEFPKKDMSVAGSLDL
KGPGQPGVSSYSPPEYELEVRFPKGNRYPFQAPIVAFSTNDESLLAAGRLHVTESLFGEA
LSAAESNQPVVYTLITLCEDENTMKELLSMRHHKYSTPPPVVGVPSPFLAIAKSKTVRSK
ASEESMNTITSSSNHANSGRAAASNNPRTTDIKRTVDAEELDEKDEDESDHTVPVKNDSY
VKLKKKMVKKQNTMGNLLLENGKLCKEFSRKQSSRRYSSMLEQRKNLPAWQEKEHILDAL
DQCQVLVISGMTGCGKTTQVPQFILDASLSGPAEQVANIICTQPRRISAMSVAQRVAQER
AECLGNSVGYQIRLESVRTSATRLLYCTTGVLLRRLEGEADLRGVTHVIVDEVHERTQES
DFLLLVLKDLMVQRPDLKIILMSATLNANLFSDYFYNCPTIHIPGRTFPVDQCFLEDAIA
KTGYVIEDGSPYMRSGKQNQSTTGARSRGDLRDVVDDLSDDVWNFMSFCNKDFVKDSVPD
QQLSLQDLTIRYKDTKKSVLKTIATMDLDKINMDLVESLLEWIVEGKHNYPPGAVLVFLP
GLAEIKMLYEQLQSNRMFNNRGVSRCVVYPLHSTLSNEEQQAVFSRPPDGVTKIIISTNI
AETSVTIDDVVYVIDSGKMKEKRYDSSKSMESLEDTWVSQANALQRKGRAGRVASGVCFH
LFTSHCFKHQLAEQQLPEIQRVPLEQLCLRIKILDVFAEQPLESVFFRLIEPPSMGSLDA
TKQRLQDLGALTTDEKLTPLGYHLACLPVDVRIGKLMLFGAIFRCLDPALTIAASLAFKS
PFVSPWDKREEANKKKLEFAVANSDHLALLQAYKGWCSAARNGHLASYLYCRENFLSWRG
LQEIASLKRQFAELLSDIGFIKEGLKARIIEQMSSKGTDGVMEATGPEANLNSRNIRLMS
AMLCAALYPNVVQVRAPQGTYKKTGTGVMKMQPKANELRFVTKNDVYVHVHPSSVNYTVR
HYNSPYLVYHEKVKTSRVFIRDCSMVSVYPLVLFGCGQVNVELHRREFVISLDDGWIRFA
AASHQVAELLKELRWELDLLLEDKIKNPSMDLCSCPRGSSIIQMIVHLISTE
Download sequence
Identical sequences I3KJ04
ENSONIP00000021099 ENSONIP00000021099 XP_005455629.1.78416

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]