SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000021427 from Oreochromis niloticus 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000021427
Domain Number 1 Region: 835-950
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.44e-21
Family Spermadhesin, CUB domain 0.003
Further Details:      
 
Domain Number 2 Region: 317-443
Classification Level Classification E-value
Superfamily Growth factor receptor domain 1.73e-19
Family Growth factor receptor domain 0.017
Further Details:      
 
Domain Number 3 Region: 27-156
Classification Level Classification E-value
Superfamily Growth factor receptor domain 6.59e-18
Family Growth factor receptor domain 0.017
Further Details:      
 
Domain Number 4 Region: 279-323
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000134
Family EGF-type module 0.013
Further Details:      
 
Domain Number 5 Region: 655-836
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000301
Family Growth factor receptor domain 0.01
Further Details:      
 
Domain Number 6 Region: 169-317
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000785
Family Growth factor receptor domain 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000021427   Gene: ENSONIG00000016993   Transcript: ENSONIT00000021446
Sequence length 1028
Comment pep:novel scaffold:Orenil1.0:GL831137.1:5070021:5143992:1 gene:ENSONIG00000016993 transcript:ENSONIT00000021446 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MHALIRASLGFVGFCLVAFVQQSASGSKTTQDVDECAEALDNCSIDAICQNTLKSYKCIC
KSGYKGDGKHCEDVDECATEYNGGCVHECINIPGNYRCTCYDGFRLAHDGHNCLDVDECS
EGNGGCQQICVNMMGSYECRCREGFLLSDNQHTCIQRPKVQPDGTKNEGPTCMDKNHGCA
HICRETQKGGISCECRPGFQLTRNMKDCKLTCNYGNGGCQHICEETDQGPKCSCHMKFVL
HSDGKTCVGESSHPDATTKVFASVDLCQRIQQYYIMETCAVNNGGCDSTCHDSVTGVRCS
CPVGFTLQPDRKTCKDIDECRLNNGGCDHVCRNTVGSFECSCKKGYKLLTNERTCQDIDE
CSFDRACDHFCVNSAGSFQCHCHKGYVLYGLAHCGDIDECSINRGGCKYGCVNTLGSYEC
TCPPGYKLHWNKKDCIEPVKCPPGLVAPKATLTCSKTGKKESCSLTCASKAHYLAESDNS
YSVSCGIPILRGKSPTRLNSNSSQSCIEALAPPVKQTASFKIKNAKCHLHPKLPGRTEDR
GRTMGQGGGQPCSNCLVTFVNLKCDSSKKAKGRRARNPSNKEVTRITLELEAEIKPTDAT
GSCNLSCLRQRMEKQVKTYIKALKKSINQERFLIRVAGLEYEVAQKLPQAAPIQENCGPG
WERDSGRCVRCLPGSYYHGEQERCVQCPPGTFQEKEGQLACDLCPGSDGHGPVGARNISS
CAGQCPTGYYSSSGFKPCLPCPQGYYQPDLGRTLCFPCGGGLNTKREGASSFHDCEVKVD
CSPGHYYNTTVHRCIRCPVGTYQTEFKQNYCISCPGNTTTDFDGATSVSQCKNRQCGGEM
GEFMGYIESPNYPGNYPANVECIWNINPPSKRKILIVVPEIFLPSEDECGDVLVMRKNSQ
GSATSITTYETCQTYERPIAFTARSRRLWINFKSNEANSARGFQIPYVTYDEDYEQLVED
IVRDGRLYASENHQEILKDKKLIKTLFDVLAHPHNYFKYTTRESNELLPRSFIRLISSKV
SAFLRPYK
Download sequence
Identical sequences I3KJY2
ENSONIP00000021427 ENSONIP00000021427

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]