SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000021494 from Oreochromis niloticus 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000021494
Domain Number 1 Region: 103-267
Classification Level Classification E-value
Superfamily RUN domain-like 2.62e-50
Family RUN domain 0.000000128
Further Details:      
 
Domain Number 2 Region: 632-698
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 1.2e-21
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.001
Further Details:      
 
Weak hits

Sequence:  ENSONIP00000021494
Domain Number - Region: 423-542
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0154
Family Myosin rod fragments 0.0049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000021494   Gene: ENSONIG00000017044   Transcript: ENSONIT00000021513
Sequence length 702
Comment pep:novel scaffold:Orenil1.0:GL831287.1:211454:228461:-1 gene:ENSONIG00000017044 transcript:ENSONIT00000021513 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASSAEHDLSLSEADTSKDKSQVFGILRLQEEKAAAGDKANSSSTVRGGGGGDGRWQAPI
FALARKASETISGSIHVLPKVSEHRTSLPGDWAVQALRDPMAMERANLLNMAKLSIKGLI
ESALSFGRTLDSDYPPLQQFFVVMEHCLKHGLKVKKSFLGFNKSLWGPLELVEKLCPEAA
EISASVRDLPGLKTPLGRARAWLRLALMQKRLADYLRLLITRKDLLSDFYENSALMLEEE
GAVIVGLLVGLNVIDANLCVKGEDLDSQVGVIDFSMYLKNDIDDYRSEERNSQIASILDQ
KNYVEELNRQLNSTVHGLQGRVDSLEKSNSKLVEELAIAKNNIIKLQEENQQLRSENSLI
LLKTQQHLELTQGDVSVERDTYKQSRQGLDEMYNEVRRQLKEECQLRQDVENELVVQVSM
KQEMELAMKLLEKDIHEKQDTLIGLRQQLDEVKAINVEMYQKMQSSDEEMKKKNDVISRL
EEKTNQITATMKQLEQRLQEAERHRTSAEEGTRRFKLDFANKADSLQRQIEHREKQLQQL
EMDLKIEREWRQTLQNDLHRERDSVAQLSTEALQINGLKKEFHRLQDENVQLKTICEDQE
KALEELGSKLSESKLKIEDIKEANKALQGGQVWLKDKEATHCKLCEKEFSISRRKHHCRN
CGEIFCNSCSDNELPLPASPKPVRVCDTCHALLLQRCSSNPT
Download sequence
Identical sequences I3KK49
ENSONIP00000021494 ENSONIP00000021494 XP_003454530.1.78416

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]