SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000021508 from Oreochromis niloticus 69_1.0

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSONIP00000021508
Domain Number - Region: 199-233
Classification Level Classification E-value
Superfamily UBA-like 0.00255
Family CUE domain 0.09
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000021508   Gene: ENSONIG00000017056   Transcript: ENSONIT00000021527
Sequence length 235
Comment pep:novel scaffold:Orenil1.0:GL831137.1:5620592:5622552:1 gene:ENSONIG00000017056 transcript:ENSONIT00000021527 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
APVKPEVELITSTPPQPVSPPKPAPTPAKTPAKMEPVNDKNDNGSGTESDSDDSVPELEE
QDSAQTQTQQAQLAAAAEIDEEPVSKAKQSRSEKKARKAMSKLGLRQVTGVTRVTIRKSK
NILFVITKPDVYKSPASDTYIVFGEAKIEDLSQQAQLAAAEKFKVPGETVSNVQENTQTP
TVQEESEEEEVDETGVEVKDIELVMSQANVSRAKAVRALKNNNNDIVNAIMELTM
Download sequence
Identical sequences I3KK63
ENSONIP00000021508 ENSONIP00000021508

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]