SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000021645 from Oreochromis niloticus 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000021645
Domain Number 1 Region: 17-115
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0000000000513
Family Motor proteins 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000021645   Gene: ENSONIG00000017164   Transcript: ENSONIT00000021664
Sequence length 138
Comment pep:novel scaffold:Orenil1.0:GL831287.1:1596841:1603927:1 gene:ENSONIG00000017164 transcript:ENSONIT00000021664 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAELLKIKREFEEFQKEYCCRNREAEENREKENQAATQIQSWFRGCKVRAYLSHLHKKAI
IIQKIWRGFTARAHVRQMVKAAYFIMKMNFYEEMAVRIQRRWRGFFVRKHIHNFYARKKY
MEGLVMKNELVRNSLEVL
Download sequence
Identical sequences I3KKK0
ENSONIP00000021645 ENSONIP00000021645

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]