SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000021764 from Oreochromis niloticus 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000021764
Domain Number 1 Region: 427-726
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.47e-74
Family Eukaryotic proteases 0.0000969
Further Details:      
 
Domain Number 2 Region: 25-139
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.96e-30
Family Spermadhesin, CUB domain 0.0000371
Further Details:      
 
Domain Number 3 Region: 187-298
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.7e-28
Family Spermadhesin, CUB domain 0.0000276
Further Details:      
 
Domain Number 4 Region: 302-372
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000417
Family Complement control module/SCR domain 0.0013
Further Details:      
 
Domain Number 5 Region: 135-183
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000147
Family EGF-type module 0.00098
Further Details:      
 
Domain Number 6 Region: 364-421
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000987
Family Complement control module/SCR domain 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000021764   Gene: ENSONIG00000017257   Transcript: ENSONIT00000021783
Sequence length 731
Comment pep:novel scaffold:Orenil1.0:GL831398.1:495708:509956:1 gene:ENSONIG00000017257 transcript:ENSONIT00000021783 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VPCRWRLVLISLIFSLGLGAQQLSLSGMYGSLRSPNFPEPYPRETQLRWNISVPDGFRIK
LYFSHFDLEPSYLCEYDYVKVEAEGEVLALFCGKEQTDTEVVPAQQALTSPRNSLSLLFS
SDFSDEERFSGFVAHYNAVDIDECSEQSDRDVLCDHFCHNYIGGYYCSCRYGYLLHSNNH
TCRAVECSSDVFRERSGVLSSIDFPAPYPKSCECSYRIEVEDGFRLHLQFDSRFDVEDHP
DVSCPYDYIKIKAGSAEFGPFCGDRSPGVIQTDSNVASVVFRSDNSGENLGWRLSYTATG
SQCPVPETPPNTLMNPFQSEYFFKDHILFTCEPGYHLLKDGGHLDHYQIDCRADGSWSDR
PPPCHMVDCGSPKMVDMADVVFGNHDNSTLFGATVQYVCREGGVQLNTSYRCGLSGDWVD
SEGRSNVSTCPGCGQLSRPLPPQVKRIVGGRSSEPGFFPWQVLLSVEDLSRVPEDRWFGS
GALLSESWVLTAAHVLRALRRDTSVIPVAADHVKVFLGLHDARDKRRATNRSVDRIFLHP
DFQPNNYNNDIALLRLSERVEFNQLIRPVCLPPPHTQDDPPAPLPNSLGVVAGWGISNPN
ASTSSSPSSTLTFDPVLDADLEMTSDLLQYVKLPVVSQAECEASYASRSISYNITDNMFC
AGFFEGGRDTCLGDSGGAFVMEDEVSRRWAVFGLVSWGGPEECGSRRVYGVYTRVAKYVE
WIESHLHAAPW
Download sequence
Identical sequences I3KKW9
ENSONIP00000021764 ENSONIP00000021764

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]