SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000021869 from Oreochromis niloticus 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000021869
Domain Number 1 Region: 467-528
Classification Level Classification E-value
Superfamily UBA-like 0.00000000000112
Family UBA domain 0.0032
Further Details:      
 
Domain Number 2 Region: 69-161
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00000000056
Family Ubiquitin-related 0.0011
Further Details:      
 
Domain Number 3 Region: 420-468
Classification Level Classification E-value
Superfamily UBA-like 0.00000000893
Family UBA domain 0.02
Further Details:      
 
Domain Number 4 Region: 364-413
Classification Level Classification E-value
Superfamily UBA-like 0.0000000105
Family UBA domain 0.028
Further Details:      
 
Weak hits

Sequence:  ENSONIP00000021869
Domain Number - Region: 229-307
Classification Level Classification E-value
Superfamily TPR-like 0.0921
Family Tetratricopeptide repeat (TPR) 0.041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000021869   Gene: ENSONIG00000017343   Transcript: ENSONIT00000021888
Sequence length 597
Comment pep:novel scaffold:Orenil1.0:GL831367.1:293288:300224:1 gene:ENSONIG00000017343 transcript:ENSONIT00000021888 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAEQNLEAKLKNLLKQEKIQLWNPPYTEQDQQPGRPHMQELAGHYAPLLGLPVSEVGGAL
ESIRAQAVKRGKGNQTFRETSVATLELLLPRDAKKDPKVRMYLETRLDVSAQQVVDRVAE
EHGLRSIKLILSGRSLSAERRLDEQGVKNHSKVMVLRVSDGELKQQLTEEEEERRSQEES
VQRTQKGFQILSERDGSEDPDTTPFLEIADQKGNPLKIPPTEKKALILAMGFHEKGRALM
KRKQHDNALCHLLQADQQFSKCGSALLSSVDNYAVLQLDIVWCYRALEALSCLEDGRSRL
QRAEDCFLRCYGEQQERLLMIKVRLSPIELLFLRLYLLQSLLSYIEGNDSQARLQLSRVE
SLYARLHPDSEKMAQLMALGFSEREARLGLRACRGDLQEAAIHISTRRQEREELKQRERQ
KRRTRMEAISALMELGFSQRDAARALHHADGNVDRAYAILLDSSQEAQATNNNTEGGASP
EKVEQLLYLGFERDSAEAALRLTGGDVQSATQLLLDNQGVLSPELLTPPSTSSSSSTPSS
EEPSSASSSPEDSELVSEVLEDIAPHEEDYLDLTLEEESELISAMKAYLHREPAHTE
Download sequence
Identical sequences I3KL74
ENSONIP00000021869 ENSONIP00000021869

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]