SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000021958 from Oreochromis niloticus 69_1.0

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSONIP00000021958
Domain Number - Region: 497-655
Classification Level Classification E-value
Superfamily Bacterial hemolysins 0.00602
Family HBL-like 0.034
Further Details:      
 
Domain Number - Region: 726-802
Classification Level Classification E-value
Superfamily Apolipoprotein A-I 0.0209
Family Apolipoprotein A-I 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000021958   Gene: ENSONIG00000017412   Transcript: ENSONIT00000021977
Sequence length 810
Comment pep:novel scaffold:Orenil1.0:GL831137.1:8882569:8901074:1 gene:ENSONIG00000017412 transcript:ENSONIT00000021977 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGTKLYQLIAQVFLLGVFLSVVHSKGTFYGGHVNPFYGNRYNLYKAGLNPHHSPNKPMTR
HKNYCAYVVQRNITCIMQDGVATYVKAEYTTKCIWGQKCPVVMYRTFYKPKYKVGFKTVT
ELEWKCCPGYSGENCYDGPTSQPDIAMPPFKGAAIPHRPSVKGFPHGPRPPIEHKPGGGQ
LEPGKPFPGIPTGKTNGNKYGISGVTGERLDRIEEDLRRLTQGLDTLNGVVTGLEDRLRT
SLREDTNKILVSLLPNKPRVPDSPVGFGLIPDGTHDGLDGAGSFTGFGDLAGRVTEVRDE
LRAKTHILEEIQGMVLGHDGQLKKLLEGAIGRPIPGPDTSSLLDELLDIKLAGIRAEILD
GFERRLTNLEKHCDQKIGEVQRECHREHMDGQQQMQQSLDGRETGLREELGSLQAQIQGL
TLTESCCGQVSSLSHRVSLLEESVKGLTESQRQLRTAFNDQTIHIDTLIETRLVDIEGRI
NATSGSFDGVEGFPGGLDGFKTLFEDKLKTLEEKVSVAVEELSNATAPALLEGQVVPALE
TEIESVRRRVEGDLDGIQKQLKHLELLCTTSCPPSTPPAGGVSGTQVEDECKEMEKKMTV
RLDSHSNQLDRLNNTLQNLLFRIAQEETEGSIQGEITLLKVNINSVNRTLKGLKDSLSFI
ASEVGHANSTWEQREHQLVNQVQGITKLMGHQASLLGAGERRLVQLKGELMSLKRQLAGE
LQGCRSTAIEVQKEVKDVDSRVTQVEGQCSNLSELADHLERIRAELERHSDSYLSQVNGT
LAIHAEQLAELKDDIKDCKAKDAANHKGDQ
Download sequence
Identical sequences I3KLG3
XP_003438928.1.78416 XP_005448869.1.78416 XP_019205786.1.78416 ENSONIP00000021958 ENSONIP00000021958

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]