SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000021992 from Oreochromis niloticus 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000021992
Domain Number 1 Region: 1125-1389
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 5.45e-74
Family Eukaryotic proteases 0.0000168
Further Details:      
 
Domain Number 2 Region: 581-849
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.6e-73
Family Eukaryotic proteases 0.00000656
Further Details:      
 
Domain Number 3 Region: 54-164
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 4.19e-31
Family Spermadhesin, CUB domain 0.00075
Further Details:      
 
Domain Number 4 Region: 859-970
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 9.03e-30
Family Spermadhesin, CUB domain 0.00075
Further Details:      
 
Domain Number 5 Region: 437-555
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.57e-29
Family Spermadhesin, CUB domain 0.00054
Further Details:      
 
Domain Number 6 Region: 976-1088
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 4.84e-29
Family Spermadhesin, CUB domain 0.00052
Further Details:      
 
Domain Number 7 Region: 179-284
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.28e-28
Family Spermadhesin, CUB domain 0.00087
Further Details:      
 
Domain Number 8 Region: 323-427
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.01e-21
Family Spermadhesin, CUB domain 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000021992   Gene: ENSONIG00000017438   Transcript: ENSONIT00000022011
Sequence length 1398
Comment pep:novel scaffold:Orenil1.0:GL831246.1:305929:329301:1 gene:ENSONIG00000017438 transcript:ENSONIT00000022011 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDVEKGHGRSRGMSTLETCLIFIFVAMTGACIGLVVIYFVDKANSETEGLTLGCGAPQEL
SGESGTFTSANYPSSYDSGQSCAWHITVDPEKVIHLWFEEFTLEDTQLCTADFITLQDSV
GVIGKYCGYNKPNPVVSLTNQLTVYFDTNDRKTDRGFKAHYKAVAPQLTSEIAGAGGFLQ
GDQGNLMTPGFPEQNYPNGALYQWRITVPEGETVRLTFTSFDLVPEACGDFVQVYDYNQA
SPQLAGKLCGGTMPTPLEISSNTMVVRFKSDNSLTSKGFSATYTKSSLPPVVVTTTTTTT
TAPTTQTLPPATTSGPGGPVILDGRKGDLQSSGFPNPYPAHLNNSWEISVSKGFLVKLEI
TDLAITGETGMCKEDKLIISDKYSTLGTHCGYILPPVVVSASDTISVTFQSDSRLTDRGF
SAKWEAVYPEDITEILGCGFSSKEETGVIKSQDWPMNYKPNTECMWNIDVPSGKKITLTF
THFDLEAKDALTSTCYDNIMVYDINGLTSALIQSYGQFCGTTLPDPIQTNGNRLLIRFHT
DLLTEAKGFRAYWTTNPSLPAPTEPPVQPNPWDNIIIDWPSTCGKPAIPPAVVSRIVNGE
PATPHSWPWQVSMQVWPASQPEPTFSHTCGGTLIHKNWVLTAAHCFIRYADELERWRMCL
GKHNLTYTEPSERCFGISGIYRHEGFKYPTVPSVEFDIALVRLDGEVTPTDEISFACLPS
EEEALPEGKKCYATGWGDETGDSINPKAAEALNQVALPVVPYDTCNRMDYWWFQVKTSMI
CCGYTLPDELKSVCQGDSGGPLVCQDKAGDPWEVHGITSFGPIGCIMDKKPSVFTRSSAY
IPWITNVIRRDLYNEHTSGCGGPKELTGTGGTLSSMGYPGTYSNTAQCQWNIQVPEGKSV
HLHFHNFSLEESDLCLNDKVRLSDKTGSLGTYCSHVPPADMVSDGNTLHISFSSNDKVVD
SGFTATWRAVDPTEVPCGGTFSSDQGEITSPNWPNDYQTQTVCTWRINIPSSRIIHVAFT
HFELQAVNLLGNCVDYVEVINGETMASLGRFCGFAPPPLISIPSNTVVIRFLSNGASQEK
GFRGYWTTDTSIFPTLPPLPSNRWDNITIIWPENCGNPEVKPSRATVRVVNGVEAIPHSW
PWQVSMQASPFSPIPYMHGCGGSLIHEEWILTAAHCFMFPLNVPSFWRMCLGKHHMNSSM
DIPSAEECYKVDTVIRHEGFVYEQDPNDITNDIALVHLAKPVNMTREISPICLPKPGVVM
PAGTPCFVTGWGDEKGNLFPKVAEKLNQAALPVIDFETCSKPAYWWDTLRPSMICAGYES
PDELKSACQGDSGGPLACTAAPAAGGTSTTWEVHGIVSFGPQGCIRDKKPSVFTRVSAFS
DWIDSNIKKYIYESGKAF
Download sequence
Identical sequences I3KLJ7
ENSONIP00000021992 XP_005456997.1.78416 ENSONIP00000021992

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]