SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000021998 from Oreochromis niloticus 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000021998
Domain Number 1 Region: 2-375
Classification Level Classification E-value
Superfamily RCC1/BLIP-II 1.48e-102
Family Regulator of chromosome condensation RCC1 0.00058
Further Details:      
 
Domain Number 2 Region: 684-1045
Classification Level Classification E-value
Superfamily Hect, E3 ligase catalytic domain 6.54e-102
Family Hect, E3 ligase catalytic domain 0.000000284
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000021998   Gene: ENSONIG00000017442   Transcript: ENSONIT00000022017
Sequence length 1053
Comment pep:novel scaffold:Orenil1.0:GL831246.1:384232:413784:-1 gene:ENSONIG00000017442 transcript:ENSONIT00000022017 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLCWGNAKDGQLGIGVEKNPVFEPRNCHVFSGRGLKEVGCGGQHSVFLMHDGSVYTCGSN
SCGQLGHDKAGISPEVVGALDTQKITMVSCGRGHSMAVNEQGQLFAWGAGDGGQLGLGTT
ETTVRIPRLVKRLCDHRISQVMCGNQHCVALSRDGQLFTWGQNTSGQLGLGKGEPSKLFP
HPLKSLAGIPLAQITAGGDHSFALSLSGAVFGWGKNRAGQLGLNDKQDRAVPCHIKFLRS
QKVVYISCGDEHTAALTKDGGLFTFGDGSWGQLGHGSTNSELLPRRVLELMGTEVSQIAC
GRHHTLAFVPSSGVVYAFGCNSHGQLGTGILGDARSPFPVKASFLTGKFHRRESKQYTVT
KIICGGDHSFLLYSNEQTSVPSEDFRVINIGKSLSPINYESLNSLRLKLMYNTDSSVTND
VIVQLSSTACWNASFLDQSDDTHFKTNPKIPGIDLNSVRMLFETLSKPAFSELMEQATKS
FESLLIPQLPRSPPDVEAMRIYLILSEYPALQDSKNYVRLTIPLAMAILRLDANPSKVLD
NWWCFVDGSVFTRMVDMYKSIVVFMLTGGKTVLVPMFYENYFLATLRLLEKLHKVNLKAQ
HVEYNRFYIPDITSLVDIQEDYLKWFLSKAEIKVGSSPSQSDFPSVNLCAYPFILNAKAK
TTMLQTDAELQMQMAVSGANLHNVFMLLTLEPHLARNPYLVLHVRRSHLVSDTLRELTMY
SDVDLKKPLKVIFDGEEAVDAGGVTKEFFLLLLKELMDPVYGMFTHYKESNLLWFSDKCF
VEQNWFHLIGIICGLAIYNATVVDLHFPLALYKKLLEVSPMRGLQNSRKLTQHSLRSLQQ
LLDYEGSDVEETFLLNFAITRENYGMTEVKELIPGGESVAVDKNNRGFIQHFVSCFCSLA
WHNSVGEQYSAFSAGFLKVCGGEILSLFQPSELMAMVVGNNNYNWEEMEKNAVYKGEYTA
THPTVRLFWEVFHEFPLEKKKQFLLFLTGSDRIPIHGMESLRIIIQSTTAEEHYLPVAHT
CYNLLDMPRYQTKEMLRRRLTQAVEQYEGFSLV
Download sequence
Identical sequences I3KLK3
ENSONIP00000021998 ENSONIP00000021998

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]