SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000022072 from Oreochromis niloticus 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000022072
Domain Number 1 Region: 212-341
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 5.32e-27
Family APC10-like 0.0035
Further Details:      
 
Domain Number 2 Region: 1783-1844
Classification Level Classification E-value
Superfamily RING/U-box 0.00000000000129
Family ZZ domain 0.0053
Further Details:      
 
Domain Number 3 Region: 1742-1792
Classification Level Classification E-value
Superfamily RING/U-box 0.000000000494
Family ZZ domain 0.018
Further Details:      
 
Domain Number 4 Region: 45-102
Classification Level Classification E-value
Superfamily EF-hand 0.00000262
Family Calmodulin-like 0.03
Further Details:      
 
Weak hits

Sequence:  ENSONIP00000022072
Domain Number - Region: 1064-1157
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.000301
Family Spermadhesin, CUB domain 0.0054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000022072   Gene: ENSONIG00000017503   Transcript: ENSONIT00000022091
Sequence length 2923
Comment pep:novel scaffold:Orenil1.0:GL831410.1:304030:333430:-1 gene:ENSONIG00000017503 transcript:ENSONIT00000022091 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PSPGVLLEQVKLREAAARISDSGVAIHESVLAGNEGVLMRWLEDRLNRGEESVNVDQFCE
MLESRDAPRDECEEAFGQFDAEGDGVVDIESMLIALKNSNGANLQGELSNVIRQLQACSL
TPGFVDIFSKTKDRLGAHASKILKFLHRNRIPSSAIPFPILEGYNSICTMRSSVVQDFLE
FLLQKEKDLDIQYRAELDRDPDVDMVKVVTQCYSTIEASSNVADIYKMTNGETASFWQSD
GSARSHWIRLKMKPDVVLRRLAIAVASNDHSYMPQLVSVAVGKNRRSLQEIRDIRIPSNV
TGYVALLENANITHPYIQINIKRCLSDGCDTRIHGLKTLGYQITKNKEMSVSDASAVWYL
SLLTSLVTASMETNPALAQTVLQSTQKALRHMPPLSLTPSSTEFPRFFSANILEEVDGFL
LRIADCCVSPDVELTLLAFALARGSVAKVIQALSCISDHLDTKYKASSLIVSMASVRLRL
LYRNGKPLQLHLQACDVKSKDEKSGPENMLTEYSTGDGFLTEAGRLKASVILSTEDQSNF
QVTQIKIKVRKGAIGPKCGLVFAYKEADPFDAEKHFKRFKKYHSWDYKDFKEFVQSSLKC
SCDKKSEDEPIGWFELEDDWNDVEIKLQQCRVAKFLMVKFLCTRQDNAERLGVQSLSFSG
YLCPGTERLADLDDLSPKGESFDSDAVTGLCLLKKTLFFIQQLTRDMLMDQRDASHCKQK
YLLEFSGLSLSLFWNFYSKLREIEGEEVMKSRVLLLQLMQNCFPMLPTPLEPRGKEESKD
DLSDPMRAVWELYTHLCHIVDSPEGETSVEKALHTEAVKAVLHGAAVFFPDKHVRRDKLF
HMMKNITEEDQPESVKVTFESLCNYFSDQDPSGLLLLPPKGAPSDFDISPILSVMETLLL
VATRECEVMMVDENSGASRSVLLSLFWALQGSLLSWCYLQLKGGASTAIAMELARDILLK
YVDQFLESVKSILGSLLERYTGAQITEKLGSSIIATVFRQLMIFLLELCPLDIPHSMLLK
SFSSLVELLRSLSSDTGDIFSKVDQENWHQPQQPVVLRTWNMESPHNYENSRHETSIFAC
PGTTSFEVEFDERCETEKRYDYLEFTDSRGGKVRYDMKVGTEKWPKKVTFDTGPQLQFLF
HSDSSNNEWGYKFTVTALGLPDITISWMSDLQLLVARLMGRLASRTLALKSPHEVRSVKE
LPSGKMSHVQSSPLWKPILRHGLCEKREANRTKTITDQVKNTTSASTWTPDELMGFLEDF
ARWNPSQELTDARTELMRTLVQACRKQTMRNEITTGSKIDQAVNAMWAAMVYHTPALNLA
LLSYVVNPDCKSSLSEEFVQVYSLADSIRTWMLEMKQRYLVGKMNIHDEREGGPDEVTME
TLAEMCIEKSLLLFRFAPCGVPCQGSDASKATESSSALLFRSSSISEGDFQASSSLGPQA
AGSESQSSSTHIANSSSCGHSRRTHRDSTESLSPQPGEPASPSAYNRKAPFSRARLRLLS
CRSIEEPRMTPSVKDRYPMLKHILNFIKDQALTTVSILQTLSLNKAQALSVCKVLEMVQQ
CFRSMGQPHLFQPPCILFLQELLACQKDFTCYFSQLSDSGQKLGEEVRRSYHQLVLMLVE
AVQGFSSLNEKAFLPALSCVQTCLLHLLDMNWEAHDLPFFLSINLPDLLLSMSQENISVH
DTAISQWTEEDEIADYKKNQEWMDECMDGMFEKWYDKIDEEESMEDRRKMHMFIARYCDL
LNVVISCDGCERMAPWHRYRCLQCMDMDLCKTCFLSGAKPEGHEDDHEMVNMEYACDHCQ
GLIVGSRINCNVCEDFDLCFGCYNAKKYPDSHLPTHRITVYPMVTIRISDRHRLIQPYIH
NYSWLLFAALALYTSELSSEKQTDGDSLDSDTLKVAKALQTHCSQLITDCLLKGQTGKGF
RSSALLALLSTNDSASDSELCPVSPESSQELSTATDTSSLPGSTAAVCSPSSPKHKKKMQ
KHVKLSQTPSVSSEDPLSPVVRPSNCGPGAVNSPTSDVVKETDDRLPPVPLQGHVFSECS
RERILGLLAAMLPPAKPGCSLCLPSLSSMLPQLFKAVISNAGSLNETYHLTLGLLGQLLL
RIPPMEADSAVTEALADKYELLIQGEMSCLDIQGWKTIQLLFSLGAVCLDSRIGLDWACT
VADILHSLNACPEWCTIIAAFTDHCVQQLPQTLKRTNLFTLLVLVGFPEGTQTVFIDNAN
EKHNMILLKHFTEKNHAAVVDVKTRKRKTVKDYQLIQSQDSCTVGLPGQPEGQGCPKTLL
SRYLGNFTSIISHLLQTSQDNGSSDAVEASWVLSLALKGLYNILKKHGVEHAHEAIQESG
LTQLLVRKCSKGTGFSKLWLLRDLEILSIMLYSSKREIHSMAQDPEREQREQDKEHDSDH
SSCCADDTDVNKPDPLEGLDEETKICFQMQITHDALNAPLPILRAMYELQMKRTDSFFLE
VQKRFDGEEIKTDETIRTLAQKWQSSRRPRSEERNTKAVDTDMIVVSCMSKPSHCEKATE
EINVVAQKLITNSESDLQLSYAKQRRTKSSALLHKELDVRSNRAVRQYLVKVNQAIATLY
ARHVLASLLADWPTDAPMSEEALELNGASHMAYILDMLMQLEERPSWEKILQRVLKGCSQ
SMLCSLSLTACQFMEEPGMAVQVRESKHPYDNNTNFEDKVHIPGAIYLSVKFDSRCYTEE
GCDELIMSSSSDFVQDVHNFSGSPQKWSDFEIPGDTLYYRFMSDMSNTEWGYKFTVTGGH
RGRFQTGFEILKQMLADDQVLSQLLLADIWEWQVGVACRQTGNQRLRAIHLLLRLLQCQS
QTRACTLTLLRPLWQLFMSMENSLSQDPTSITVLLPLHRALTELFFIAEARAIAQGVLQE
YLLAMTTDEQLLNHTAMALKNIAAISLAINYPNKSTKLLNMSP
Download sequence
Identical sequences I3KLS7
ENSONIP00000022072 ENSONIP00000022072

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]