SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000022312 from Oreochromis niloticus 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000022312
Domain Number 1 Region: 129-275
Classification Level Classification E-value
Superfamily Thioredoxin-like 2.46e-33
Family UAS domain 0.034
Further Details:      
 
Domain Number 2 Region: 314-443
Classification Level Classification E-value
Superfamily Ubiquitin-like 2.84e-21
Family UBX domain 0.0062
Further Details:      
 
Weak hits

Sequence:  ENSONIP00000022312
Domain Number - Region: 10-48
Classification Level Classification E-value
Superfamily UBA-like 0.000204
Family TS-N domain 0.054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000022312   Gene: ENSONIG00000017695   Transcript: ENSONIT00000022331
Sequence length 445
Comment pep:novel scaffold:Orenil1.0:GL831174.1:2018944:2024000:1 gene:ENSONIG00000017695 transcript:ENSONIT00000022331 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAPEEPELSQAQTEKLLQFQDLTGLESMDQCRRTLEQHNWNIEAAVQDRLNEQEGVPSV
FNPPPSRPLQVNTADHRVYSYIVSRPQPRGLLGWSYYLIMLPFRFTYYTLLDIFRLALRF
IRPDPRGRVTDPVGDVVSFIHSFEEKYGQAHPVFYQGTYSQALNDAKRELRYLLVYLHGD
DHQDTDEFCRSTLCTEEVITFLNTRMLFWACSTSKPEGYRVSQALRENTYPFLAMIMLKD
RKMTVVGRLEGLIQPEDLINQLTFIMDANQTYLMSERLEREERNQTQVLRQQQDEAYLVS
LRADQEKERKKREEQEQKRQEEEKVRQSALAEERRRRTLEEEKERKSECLPPEPLADDPE
SVKIVFKLPNDTRVERRFLFGQSLTVIHDFLFSLKETPEKFQIVTNFPRRVLPCLPTEEQ
PNPPTLKEAGLSRSEVLFVQDLTDD
Download sequence
Identical sequences I3KMG7
ENSONIP00000022312 XP_003445899.1.78416 ENSONIP00000022312

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]