SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000022365 from Oreochromis niloticus 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000022365
Domain Number 1 Region: 346-447
Classification Level Classification E-value
Superfamily SRCR-like 1.31e-44
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0000722
Further Details:      
 
Domain Number 2 Region: 863-965
Classification Level Classification E-value
Superfamily SRCR-like 1.7e-44
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0000533
Further Details:      
 
Domain Number 3 Region: 535-637
Classification Level Classification E-value
Superfamily SRCR-like 2.49e-44
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0000636
Further Details:      
 
Domain Number 4 Region: 1087-1189
Classification Level Classification E-value
Superfamily SRCR-like 5.36e-44
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0000562
Further Details:      
 
Domain Number 5 Region: 968-1070
Classification Level Classification E-value
Superfamily SRCR-like 1.44e-43
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0000699
Further Details:      
 
Domain Number 6 Region: 213-315
Classification Level Classification E-value
Superfamily SRCR-like 2.62e-43
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0000762
Further Details:      
 
Domain Number 7 Region: 3-104
Classification Level Classification E-value
Superfamily SRCR-like 1.31e-42
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0000791
Further Details:      
 
Domain Number 8 Region: 103-208
Classification Level Classification E-value
Superfamily SRCR-like 4.71e-42
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0000986
Further Details:      
 
Domain Number 9 Region: 749-832
Classification Level Classification E-value
Superfamily SRCR-like 3.92e-30
Family Scavenger receptor cysteine-rich (SRCR) domain 0.00017
Further Details:      
 
Domain Number 10 Region: 451-532
Classification Level Classification E-value
Superfamily SRCR-like 1.83e-27
Family Scavenger receptor cysteine-rich (SRCR) domain 0.00032
Further Details:      
 
Domain Number 11 Region: 642-729
Classification Level Classification E-value
Superfamily SRCR-like 1.44e-26
Family Scavenger receptor cysteine-rich (SRCR) domain 0.00031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000022365   Gene: ENSONIG00000017739   Transcript: ENSONIT00000022385
Sequence length 1190
Comment pep:novel scaffold:Orenil1.0:GL831321.1:1228865:1349933:-1 gene:ENSONIG00000017739 transcript:ENSONIT00000022385 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VSPVRLVNSEDSCSGRVEILHDEQWGTVCDDLWDLNDAKVVCRQLGCGRARAALQSAAFG
PGSGPIWLDDVSCVGDESSIADCTHRGFGVQNCGHGEDAGVVCDSASPMRLVNGNNSCSG
RVEVLHAGQWGTVCDDLWDLNDANVVCRQMGCGQARAALQSAAFGQGSGHIWLDDVSCLG
NEQSMTDCKHQPFGVHNCVHGEDAGVICEFNSPVRLVNGHSYCSGRVEVFNAGEWGTVCD
DSWDLNDVSVVCRQLGCGRARAALQSAAFGQGSGPIWLDDVACSGSELSLTDCSHSGFGV
HNCGHSEDAAVICESNKNLKVRDCSANQSKTNRSGCGEQVYLKADSPLRLVNGENRCSGR
VEVFNNGQWGTVCDDSWDLNDASVVCRQLGCGRARSALRNAAFGQGSGPIWLDDVACFGN
ELSITQCSHPGFGVHNCRHGEDAGVICDVEGEVRLVNGNSSCSGRVEIFHSGQWGGTVLS
APTNAQFGQGNGPIWLDDVTCTGNESKLSECQHRGFGSHDCSHSEDAGVVCEAPSSVRLV
NGENRCSGRVEVFNDGQWGTVCDDLWDLNDANVVCRQLGCGSARSALQNAAFGQGSGPIW
LDNVDCVGNESSITDCRHNGLGVHNCGHNEDASVVCEFFRKQQLVNGNSSCSGRVEIFHS
GQWGTVCDDFWDLNDANVVCRQLGCGIARSSSLQNAAFGQGSRPIWFDNFTCVGKYRQSV
LFPCGNTVCPSGMDCINSQCVDPYCTVEGEVRLVNGNSSCSGRVEIFHSGQWGTVCDDAW
GLVDAQVVCSSGPIWLDDVDCFGNEPSITDCRHNGLGVHDCVHYEDASVVCEFSKTRTPP
HCQSITEPCAVSFFFFPFCPVEGEVRLVNGNSSCSGRVEIFHSGQWGTVCDDAWGLVDAQ
VVCRQLGCGRVFSAPTNARFGQGSGPIWLDDVACTGSESTLSECHHRGFGSHNCGHSEDA
GVVCEAASSVRLVNGQNRCSGRVEIFNDGQWGTVCDDLWDLNDANVVCRQLGCGSARSAL
QNAAFGQGSGPIWLDNVYCVGNEPSITDCRHNGLGVHDCRHNEDASIICDANISTTTPVG
NSTAVKGEVRLVNGNSSCSGRVEIFHSGQWGTVCDDAWGLVDAQVVCRQLGCGRVFSAPT
NARFGQGNGPIWLDDVTCTGSESRLSECQHRGFGSHNCGHSEDAGVVCEG
Download sequence
Identical sequences I3KMM0
ENSONIP00000022365 ENSONIP00000022365

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]