SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000022381 from Oreochromis niloticus 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000022381
Domain Number 1 Region: 63-226
Classification Level Classification E-value
Superfamily RUN domain-like 4.18e-48
Family RUN domain 0.000000271
Further Details:      
 
Domain Number 2 Region: 589-658
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 6.24e-19
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.0013
Further Details:      
 
Weak hits

Sequence:  ENSONIP00000022381
Domain Number - Region: 247-314
Classification Level Classification E-value
Superfamily Prefoldin 0.000602
Family Prefoldin 0.0071
Further Details:      
 
Domain Number - Region: 422-534
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0191
Family Myosin rod fragments 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000022381   Gene: ENSONIG00000017751   Transcript: ENSONIT00000022401
Sequence length 661
Comment pep:novel scaffold:Orenil1.0:GL831174.1:2713648:2719821:1 gene:ENSONIG00000017751 transcript:ENSONIT00000022401 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PQVAEENSWSAPLLSLARKATETISSGISYAAVQRKPSQGSAASSPTENEAEIVPPKDSM
AIERSNLLSMLKLSIRVLIQSSMSLGRTLDSEYPPLQQFFVVLEHCLKHGLKAKKSFIGH
NKSIWGPLELVEKLCPESVNIATSARDMPGIKTGLGRGRAWLHLALMQKKVADYMKALLD
HKDLLSEFYDSGALMLEEEGSVMVGLLVGLNVIDANLCIKGEDLDSQVAVIDFSLYLKDP
ASNETPKDDSKMTAILDQKHYIEELNRHLSGTVTDLQAKMDSLEKTNSKLVEELTAATDR
INSLREEQEQLKKENETILQSSQRKEEAVLQDSQAELETYKQTRQGLDEMYNVVWKQYKE
EKRIRQELERELELQVGMKQEIEVAMKLLEKDTHEKQDTLAALRLQLDQVKTLNVQMFHK
AQDSDRQAEKKQAEAVQLEQRMNEMENTMKELEQRLQRSEQERKQNDQSDEDMKAELQGK
VDALQKQLTDLDTLRLGLENELRSEREQRQNLQKTLQREQDNSTELRTQLQQLQGLHSEL
QELKQEKQQLQQKCEQQEQALQEMGLHLSQSKLKMEDFKEVNKALKGHAWLKDDEATQCK
QCQKEFSISRRKAQHHCRNCGDIYCNSCSSNELALPSYPRPVRVCDVCHSLLLQRSSSTG
S
Download sequence
Identical sequences I3KMN6
ENSONIP00000022381 ENSONIP00000022381

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]