SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000022432 from Oreochromis niloticus 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000022432
Domain Number 1 Region: 789-1042
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 2.14e-88
Family Eukaryotic proteases 0.00000544
Further Details:      
 
Domain Number 2 Region: 370-526
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 5.54e-37
Family MAM domain 0.0046
Further Details:      
 
Domain Number 3 Region: 555-658
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 9.94e-31
Family Spermadhesin, CUB domain 0.0011
Further Details:      
 
Domain Number 4 Region: 245-358
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 7.85e-21
Family Spermadhesin, CUB domain 0.0011
Further Details:      
 
Domain Number 5 Region: 665-704
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000000916
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 6 Region: 50-127
Classification Level Classification E-value
Superfamily SEA domain 0.0000000000484
Family SEA domain 0.01
Further Details:      
 
Domain Number 7 Region: 205-246
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000017
Family LDL receptor-like module 0.0021
Further Details:      
 
Domain Number 8 Region: 713-791
Classification Level Classification E-value
Superfamily SRCR-like 0.0000085
Family Scavenger receptor cysteine-rich (SRCR) domain 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000022432   Gene: ENSONIG00000017794   Transcript: ENSONIT00000022452
Sequence length 1055
Comment pep:novel scaffold:Orenil1.0:GL831363.1:130574:178291:1 gene:ENSONIG00000017794 transcript:ENSONIT00000022452 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LSSLEILLIIISSLLLICCIGLAVVSSLSLKPKVCQGATEPVQLMGRMVIVEGAVFSEEL
KNFSSPQFKSLAFDVQQLVSEAFSASELRQLYESCWVQDFSRGSVVVTFSLRFSQLIDVK
EVEQVLGAGLQRIEGGVLVIDTKTISITVGASLFYSFPSVTTSTELTASGTTSAATASAA
ITASQTSGTTVSAGTSINPTGGDAPSVTCGPYQTPCADEMTCILTSQLCDGVDDCPDASD
ETDALCATACDGQFVLRGPIGLFSSSKSDKYNSSSFCRWIIRVDDGLSVQVTFPQFETEE
NSDTLRLYEGVGPNKVLTGESHSSTSPGNVWLLTNQSTVEFTSDDINNLSGFIATYSAAN
TSTLSNEDKLTCTFEQGMCFWRQQQDDNGDWFRIRGPTFPSLTGPSVDHTLGNSSGFYIV
TSKSPGQWEKSFRLDSLPLTPSMQPMCLSFWYHMFGQDVHQLRLWLLMESDVTVFQKDGD
YGDTWNYGQVTLNLTSEAMVVFEALKKGGMLNDIALDDITLTSDACGPAPPEPTNVPPPT
TTPPIPADCGGPFDLWEPNSTFNTPNYPESYGNGAECLWTLHALEGHNIQLHFLDFDIEA
SSDMVEVRDGAGSNSTLLAVLTGNGPTHDLFSTANQVTVWFYTDSSVSGKGFRANFTSGV
NLGSPAPCADGQFQCQTGSCIHGNNQCDGVVDCPDGSDEAKCVMLQVNGSSRLQVQIVSS
LFTVCTDTWNSQLSNFTCQYLGYRSGEASFLQARPQDSPFALITISSDGTLKTNISETCH
REEVMSLACNNQPCGVRQVTNVSSAGRVVGGVNAEEGAWPWIVSLLWRGHHACGASVIGS
DWLLTAAHCVYGKNVDLQSWSAVLGLHAQNDQTSEAVQTRQVDRIVFNEQYNRRTKQADI
AMMHLQQPINFTQWVQPVCLPPEGQNFTAGRKCFIAGWGRDTDDNSGSLPNVLQEAKIPL
VDQNLCQQQLPEYTITSSMLCAGYPEGGVDSCQGDSGGPLMCLDDGSWTLIGVTSFGAGC
GLPQKPGVYARVSAFTSWIAQTRRSSSSSHFKDPL
Download sequence
Identical sequences I3KMT7
ENSONIP00000022432 ENSONIP00000022432

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]