SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000022597 from Oreochromis niloticus 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000022597
Domain Number 1 Region: 208-531
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.15e-88
Family Protein kinases, catalytic subunit 0.0000000841
Further Details:      
 
Domain Number 2 Region: 65-135
Classification Level Classification E-value
Superfamily Cysteine-rich domain 1.32e-19
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.0032
Further Details:      
 
Domain Number 3 Region: 6-57
Classification Level Classification E-value
Superfamily CAD & PB1 domains 0.0000000000000385
Family PB1 domain 0.00042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000022597   Gene: ENSONIG00000017929   Transcript: ENSONIT00000022617
Sequence length 551
Comment pep:novel scaffold:Orenil1.0:GL831283.1:177439:290133:1 gene:ENSONIG00000017929 transcript:ENSONIT00000022617 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MCSVASQQPITLKWIDDEGDPCTISSQMELEEALRIYSRTKRSGLLLHVFPSIPEQPGML
CPGEDKSIYRRGARRWRKLYRVNGHLFQAKRFNRKAYCAHCSERIWGLGSQGYKCINCKL
LVHKRCHRLIPQTCQRLMDPVMPSQKPPSDAQSAEVDLPLDDTEDTDGIPFLPHNCAVNK
AEDETEDVKAVVDGIDGIKISQGLVLGLGDFDLIRVIGRGSYAKVLLVRLKKNEQMYAMK
VVKKELVHDDEDIDWVQTEKHVFEQASTNPFLVGLHSCFQTESRLFLVIEYVNGGDLMFH
MQRQRKLPEEHARFYAAEICIALNFLHEKGIIYRDLKLDNVLLDHEGHIKLTDYGMCKEG
IRPGDTTSTFCGTPNYIAPEILRGEDYGFSVDWWALGVLMFEMMAGRSPFDIITDNPDMN
TEEYLFQVILEKPIRIPRSLSVKAAGVLKGFLNKDPKERLGCQVQTGFTDIKSHTFFRSI
DWEQLEKKEVTPPFKPQISDEYGLENFDTQFTNEPVQLTPDDEDVIKRIDQSEFEGFEYI
NPLLLATEESV
Download sequence
Identical sequences I3KNA2
ENSONIP00000022597 ENSONIP00000022597 XP_019205335.1.78416

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]