SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000022615 from Oreochromis niloticus 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000022615
Domain Number 1 Region: 328-366
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000236
Family LDL receptor-like module 0.0009
Further Details:      
 
Domain Number 2 Region: 127-242
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.000000000445
Family Spermadhesin, CUB domain 0.0041
Further Details:      
 
Domain Number 3 Region: 5-80
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.00000196
Family Spermadhesin, CUB domain 0.0039
Further Details:      
 
Domain Number 4 Region: 89-130
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000209
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 5 Region: 281-327
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000615
Family LDL receptor-like module 0.0038
Further Details:      
 
Weak hits

Sequence:  ENSONIP00000022615
Domain Number - Region: 241-279
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00055
Family LDL receptor-like module 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000022615   Gene: ENSONIG00000017944   Transcript: ENSONIT00000022635
Sequence length 646
Comment pep:novel scaffold:Orenil1.0:GL831508.1:186908:193800:-1 gene:ENSONIG00000017944 transcript:ENSONIT00000022635 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSDGWIITGPEDEPIVLSFSQFSVRCKKEWVSINSSAGGDPIILCGSKLPQPIELPGGNI
TVTHHFLPHLFPVSSFLLNYARDPYEGDCPESSFRCYGGRCLPLSWRCNGQVECLDEESD
DNDELGCDCPCGGLLQTFYGTFSPPGCQGQSKSCVWTLDPQDSRPLRLELQKLTLAFEDR
LTVYNREEGKENPSVFSQITSSSNSKSVQVESNTGVMSVVYKGVLGTENSNFNATFHVKG
YCPPWEGRCGGAAEGCFTQEQHCDGKWDCPETGKDEEGCRNCSPNHFPCGMAGQRTTATS
KAQCYSLAERCNYQLNCADGSDERDCTVCQPGTFHCDSDRCVYESWRCDGQVDCKDGTDE
LNCTVILPRKVITAATVGSLVCGLLLVIAMGCTCKLYSLRTREYSMFAPINRHEAELIQQ
QAPPSYGQLIAQGIIPPVEDFPIENPNETSTLSLRGILQLLRQDAASSPHRRRRPRFIRR
AVRRLRRWGLIPRSNTATSGQETARSTPGSSPSAVEAVNQPVAQKLGLLAQPVQQQLEAP
PPLLPLPSPPPIAFPPPPPYAPPAPPVDAPHTPPVAVPPSSPSLASIFHTIGLSISRFRA
SPSSTNYVPLSASPSFSSASSSSDDDVLLIPLSEDNTSEDDVPMLT
Download sequence
Identical sequences I3KNC0
ENSONIP00000022615 ENSONIP00000022615

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]