SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000022658 from Oreochromis niloticus 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000022658
Domain Number 1 Region: 73-475
Classification Level Classification E-value
Superfamily RCC1/BLIP-II 4.97e-89
Family Regulator of chromosome condensation RCC1 0.00036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000022658   Gene: ENSONIG00000017984   Transcript: ENSONIT00000022678
Sequence length 494
Comment pep:novel scaffold:Orenil1.0:GL831283.1:1776630:1795872:1 gene:ENSONIG00000017984 transcript:ENSONIT00000022678 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPRKKVTDVSGNGGMKRKRASGKRRERDFSSDDEFDFEQENNKKSGKPTTKSGLQPVTVA
DDVKEKIKLECPKVKGQLLIFGATNWDLIGRKEVPKQQAAFRNLGQNLWGPHRYGCLNDV
QVSCVVSGPCAAHSLFITTEGKLWSWGRNDKGQLGHGDTKRLEAPKLIEALAEHVIVSVA
CGRNHTLALTEDGAVYSFGENKLGQLGQGNQTDAVLTPALISYNGQPLVKVACGAEFSMV
VDCKGNLYSFGCPEYGQLGHNSDGKFIARAQRIEFDCELIPRRVAIFIEKSKDGQIMPVP
NVVVRDVACGANHTLVLDSQKRVFTWGFGGYGRLGHTEQKDEMVPRLVKLFDFPGRGASQ
IYAGYQCSFAVSEMGGLFFWGVTNTSRESTMYPKAVQDLCGWKIRSLACGKSSIIIAADE
STISWGPSPTFGELGYGDTKPKSSTTAQEVKTLDGIYIEQVVMGYSHSLVIARQDTQQEQ
EKLKKLPEYNPRTI
Download sequence
Identical sequences I3KNG3
ENSONIP00000022658 XP_003454294.1.78416 XP_005458860.1.78416 ENSONIP00000022658

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]