SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000022832 from Oreochromis niloticus 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000022832
Domain Number 1 Region: 974-1040
Classification Level Classification E-value
Superfamily UBA-like 7.05e-16
Family UBA domain 0.00014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000022832   Gene: ENSONIG00000018123   Transcript: ENSONIT00000022852
Sequence length 1569
Comment pep:novel scaffold:Orenil1.0:GL831193.1:1594220:1639083:-1 gene:ENSONIG00000018123 transcript:ENSONIT00000022852 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEEKKKKKQEEKTKKEIAQKKAADQKPKDISLQCGPGAQYEISYWGASVPVESPSSANSW
DKVIIDKSDTEAWPSISRSSDPSNPVTTECPSGSTSSNLDTSAVTTTCRSSFVSMATGAA
GQQAHYPSLKANNNMMTGPGSTNALVGNRGWVSDGKQDGMNSGRVGAPNNWGSSNFNLNL
NPNANPSAWPVLGHESVGGGTTGVSSSSSLPPGINGNGNLGNGNMGGADNGGGSWVGMMS
ATENEQQHPSTNTNLSFNMEPVNLNTDGPNHTKQQQAQEPMSPIHGLTGWGGQSPTESSQ
LNGDTTGSSVWGSGETKAADSPKDSSWDSTTSGGLSAWGRQGSGGGSSGSGGWGDWGKSS
AGGEASKGWDSIDAGSSGSGQDQQLSSWGQQLGTAPASEDSGDSSEGRSHRRDRSSSMEF
APLLPRQDLDPRVLSNTGWGQTPIRQNTVWEMEEANSDDGKSSSSSDTIGASSSNGGPSS
TNGTITPTIAPRPGSGGKSDSEGSSSSGWGAPVSQPVQTGSGWGDPPQSLSKAPNGTTSG
WGDPLPSNGPKNGGTSSWGSEDKSSSWDNGLVKSQPTSWGEGPKNAHGWGNSNGGSNGST
TGEWGEPDIKNNGSSSSMWEGEGNNGGNSGWKESPRGGNGGGWGKTPAVSNSSWGETSRA
NGPVQSGWGSSKPQESSSSSTGSGGGGSIGSWGGPSSVKQNNSSWGNVSKQDQGMEPTGW
EEPSPPSIRRKMEIDDGTSTWGDPSAYNKTVNMWDRNNPNSNPGNSGPPPSKNGGMIIPN
NNNNNHSVGPGNNNHHHPHPHHMHHHPHHGQPPTHLQHHGNNNGSPNNAASHPSVGPQGR
PTLSNPGWGEIPSVQPKSEPAWGEPAAPTSAVDNGTSAWGKPPGGVGGWGDGGHESSGPY
GRGSGPPGSAPCKPGPKPMQDGWGNGGEEMGMSTSQWDTEDGDVWNSPTSQESSSSCNSW
SNGPKKCPNKGKMGNKPDEAWIMNRLIKQLTDMGFPRDPAEEALKSNNMNLDQAMTALLE
KKTDLDKRGMGMSDYSNGMNKPLVCRPSALSKDPSERTAFLDKDGVLSDDTPPSPFLPSP
SLKLPLANSSLPGQGLGQGNPGLAMQNLNRQIPSGMFGSSGAAQTRAMQQQPPQPPVPPL
SSSQPSLRAQVPQFLSPQVQAQLLQFAAKNIGLNPALLTSPINPQQMTLLYQLQQLQMAY
QRLQIQHQMMQAQRNVSGPIRQQEQQVARTITNMQQQIQQHQRQLYQALLMKQQQLPSHS
SSSSSSAGLHPPGGPAGGPGSGKSTLDPFTGTHQAPSLADTLHTKEPPSSPSAYSTYPLS
GLNPNMNVNCMEVGGLSLKEPPQPQSRLSQWTHSNSMDNLSGNSSNLENNLNKHGAISAA
STLVPPGKPPQLEDSYSPYNLISSSESPTSPLVPPDWGQGKSPSEKISNGTNINWPPEFC
PGVPWKGLQNIDPENDPNMTPGSVPSGPTINTNIHDVNRYLLRDRNGGKLSDMKSTWSPG
PISQSQASLSHELWKVPQGPRSTTAPSRPPPGLTNTKPSSTWGGNSLGLSQGWSGSYSSG
EHSISFYQK
Download sequence
Identical sequences I3KNY7
ENSONIP00000022832 ENSONIP00000022832

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]