SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000022864 from Oreochromis niloticus 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000022864
Domain Number 1 Region: 11-289
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 7.15e-66
Family Protein kinases, catalytic subunit 0.00011
Further Details:      
 
Weak hits

Sequence:  ENSONIP00000022864
Domain Number - Region: 301-356
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.054
Family Ubiquitin-related 0.022
Further Details:      
 
Domain Number - Region: 460-516,551-644
Classification Level Classification E-value
Superfamily Bacterial hemolysins 0.0706
Family HBL-like 0.057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000022864   Gene: ENSONIG00000018146   Transcript: ENSONIT00000022884
Sequence length 764
Comment pep:novel scaffold:Orenil1.0:GL831200.1:1695234:1716361:1 gene:ENSONIG00000018146 transcript:ENSONIT00000022884 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MERPPFRQNQDFGDWELKERLGMGGFAHVYLYQHMQTHEKLAIKMCRLELTPRNKDRWSR
EIQIMKKLNHINIVTAQEVPEEVEPIALNDLPLLAMEYCSRGDLRKVLSKPENCCGLKES
EVLSLLNDVGSGIQYLHENKIIHRDLKPENIVLQDINGKLVHKIIDLGYAKDLDQGSLCT
SFVGTLQYLAPELFENKPYTVTVDYWSFGTMIFECSCGFRPFLHNLQPVQWASKVRNKGP
KDIMAVEELNGEVRFSTHLPYPNNLSRTLLEPMEALLQLMLKWDPVHRGGQVNHETKKPL
CFELLEQILSMKVVHILNMTTAQVHSFQLTPDESLHSLQKRIEAETKIEVVNQELLQETG
VSLDPRKPAAQCVLDGVMNRGWDSYIVYLFDKSITKYTGPFSARRLPEKVNTIVQDAKTQ
LPLVVMKKVWGEAVSYICGLKDDYSRLFQGQRAAMLSLLRYNTNLTRCKNSMFGFSQQLK
AKLDFFKSSIQYDLEKYSDQMHYGISSEKMLKAWQENEERAAAFAQVAEVSHLDDEIMAL
HSEIVELQRSPYARRQGDKMEQLEEKAIELYRQLKMKCKVPDSDVSCDSSEMVKAIIQTV
QNQDKVLKDLFTHLSKILISKQKIIDLFPRIDKTLESIKDADNTVMQMQIKRQREFWHLL
KIACAQNSSRSSIAASPESSNLLQVSQWSQSAQPVSSPHPLTSLPGPNDSDAAPRLLQEN
QKYLSQLTSLMQEAADEQAKSIVDQDWSWTKYETLTTKLKKRNS
Download sequence
Identical sequences I3KP19
ENSONIP00000022864 ENSONIP00000022864

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]