SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000023040 from Oreochromis niloticus 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000023040
Domain Number 1 Region: 17-185
Classification Level Classification E-value
Superfamily RUN domain-like 8.11e-38
Family RUN domain 0.0014
Further Details:      
 
Domain Number 2 Region: 540-648
Classification Level Classification E-value
Superfamily PH domain-like 9.44e-18
Family Pleckstrin-homology domain (PH domain) 0.0095
Further Details:      
 
Domain Number 3 Region: 693-796
Classification Level Classification E-value
Superfamily PH domain-like 0.000000249
Family Pleckstrin-homology domain (PH domain) 0.018
Further Details:      
 
Weak hits

Sequence:  ENSONIP00000023040
Domain Number - Region: 842-859,1016-1057
Classification Level Classification E-value
Superfamily Multiheme cytochromes 0.00893
Family Cytochrome c3-like 0.067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000023040   Gene: ENSONIG00000018298   Transcript: ENSONIT00000023060
Sequence length 1070
Comment pep:novel scaffold:Orenil1.0:GL831200.1:3608071:3618749:-1 gene:ENSONIG00000018298 transcript:ENSONIT00000023060 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
NLCLVNKALRPQIISIIKEKLAQSLKALQKRYVASDSVVTSDDSDANLLCCALEAIFIHG
IKSKYIRSESRSSSRKGDRGPLPQPFFWSLLKSVTHRDVVTELEKISFVGTDVGRCRAWL
RLALNHGLLECYLVSLFREDSKLKAHYQPSALLLNPEEREVLLSYLQGLASLTFSLSYKS
SVLNEWTTTPLALAGLCPLSQADLLDLPLNGGDPPTSKPICKEIWDTVSQSSGSSDALDV
QRGCPVLVGRGSDLLQGSQTALRSSNLSLDTTGSSQLSSSLSSDSLLQGQDPRSPTGEHW
SSCDLEAAINPNICTKRPQKEYFLFFFGLSSTKAFLLFNLNSLTDFRESGHCSQDSTQED
SFVSSMGPSQFSEKGIISDSEPQASEYQPPNFGQLDLEQPETTTELPSSDDDKCPPEVCK
SASSELHSDIGLVSAVSEPAEPVEEHSYSWISDDDIYKPHLENLPDSDDAPVSPPAAEPS
ISPSRPSVVHRRQIGTTPCLPGFENRSLHSSERNRVVKEQTKQKPTFCFRAANRNSVGLF
NPFRGLLKLGHLERRSAVGLWRDYYCELSPFEFRLYVNAEERICCENCSLVRCEDVRITS
SEGRFELIFPGKRLNLRAANRDEAEDWVDRIIEAVNKSRPVPHDEQWEVLHTGSLAPSSP
EQGPSGSDACGGQDSPSPPQQDFDWTSTADLETDSIKEAVLYFSTDPEARTWERMVFSLS
LETLKGFLVKEGRKLQRLNYPVEEIRDVVPDVSQGGPAFFKLLTIRETLRFRAENEKEAR
FWRKFIRDALDSYLENGECEGSEVPLEATGNLYRLVQHRLKEDGALLVHLFKVPSEKGLD
TQSFKCAGCPQKIGLSLGRARLCEFSGKYYCESCHKGNTSIIPSRMVHNWDVTQREVSKK
ALWLLKQVEQEPLLNLEQLNPELVAHAESMGQAHEQRQKLCLLGEYLRTCRSGACKKLQA
RMGQRTYLLESNHLYSVKDLRQVAEGQYVNFLRTLVQHASNHVFSCDLCTQRGYICQICH
SSDTIFPFQFETTTRCEDCKALFHISCKADGQSCPRCQRMRKYMERDLRD
Download sequence
Identical sequences I3KPJ5
ENSONIP00000023040 ENSONIP00000023040

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]