SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000023250 from Oreochromis niloticus 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSONIP00000023250
Domain Number 1 Region: 56-311
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 6.2e-98
Family Protein kinases, catalytic subunit 0.0000103
Further Details:      
 
Domain Number 2 Region: 668-779
Classification Level Classification E-value
Superfamily KA1-like 7.63e-46
Family Kinase associated domain 1, KA1 0.00000544
Further Details:      
 
Weak hits

Sequence:  ENSONIP00000023250
Domain Number - Region: 325-369
Classification Level Classification E-value
Superfamily UBA-like 0.0062
Family UBA domain 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000023250   Gene: ENSONIG00000018468   Transcript: ENSONIT00000023270
Sequence length 779
Comment pep:novel scaffold:Orenil1.0:GL831242.1:1220771:1260734:1 gene:ENSONIG00000018468 transcript:ENSONIT00000023270 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSTRTPLPTVNERDTENHSSVDGFVEPQAPPTKSASRHSLPRCRNSFTSTEEHPHIGNYR
LLKTIGKGNFAKVKLARHVLTGREVAVKIIDKTQLNPTSLQKLFREVRIMKILNHPNIVK
LFEVIETEKTLYLVMEYASGGEVFDYLVAHGRMKEKEARAKFRQIVSAVQYCHQRRIVHR
DLKAENLLLDADMNIKIADFGFSNEFTVGSKLDTFCGSPPYAAPELFQGKKYDGPEVDVW
SLGVILYTLVSGSLPFDGQNLKELRERVLRGKYRIPFYMSTDCENLLKKLLVLNPVKRGS
LEQIMKDHWMNVGHEEEELKPYIEPEADFSDSSRIELMVTMGFPKDEITDSLQSQKYDEV
MATYLLLGRKAPEFEGSEPLANSILGQRQRPTSDINNSSSISPAHPKVTRSISTNQKQRR
YSDHVGPSVPPAVSYTKRGQALSVESDHREEWDGARRLELSTSKGDVPASPLGVQERKKT
TSAVGHKQTNGSMTRRNTYVCERSSTDRYSAIPNGKDSSLTEVSGSTPSTAMSSTRPRHT
KSMSSSGHPSKSTLPPIDDNTELKASSSPRGPSTSPSAHSISTPEKNRFPRGTTSRSTFH
GAQLRDRRSATYNGPPASPTLSHDTGALAQQRRGTSTGIISKITSKFVRRVPSEGEASAR
TETPRSASGDTKEDGGRDSKPRSLRFTWSMKTTSSMEPSEMMREIRKVLDANSCDYEQRE
RFLLFCVHGDARQDNLVQWEMEVCKLPRLSLNGVRFKRISGTSIAFKNIACKIANELKL
Download sequence
Identical sequences I3KQ55
ENSONIP00000023250 ENSONIP00000023250

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]