SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSONIP00000023289 from Oreochromis niloticus 69_1.0

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSONIP00000023289
Domain Number - Region: 148-183
Classification Level Classification E-value
Superfamily UBA-like 0.00386
Family UBA domain 0.081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSONIP00000023289   Gene: ENSONIG00000018497   Transcript: ENSONIT00000023309
Sequence length 283
Comment pep:novel scaffold:Orenil1.0:GL831242.1:1604395:1606900:1 gene:ENSONIG00000018497 transcript:ENSONIT00000023309 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDLHKIIHSALHEFIQTYIPDADLSTLDDVLLSYITGVLEDLGSQQSVEENFDVEDFAEM
LEAYIPGFAEIDSVKVCEMMFSLASKLATARTSAREENGIPKARTEEISLKLTSLPSEPP
RRETQCLKSQTEGATAKPPVSEWDAQEQHLLEMFPKCSLTEARSALSIAKGDMEEAVRLI
IEGDVQLSPTPLNVNQGKSISSLADQKLKESILEKYMLVDREEDKKTHRPVVPKDAPKKL
VRYHGNQVVTTKGERYQLVKKDETEDMKKTYVNLKPARKYRFH
Download sequence
Identical sequences I3KQ94
ENSONIP00000023289 XP_003451991.1.78416 XP_005456638.1.78416 ENSONIP00000023289

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]